Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62950 91 / 9e-25 RNA polymerase II, Rpb4, core protein (.1.2.3) AT3G28956 84 / 2e-21 RNA polymerase II, Rpb4, core protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039583 [exp] 125 / 4e-38 AT5G62950 119 / 1e-35 RNA polymerase II, Rpb4, core protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G067600 [exp] 96 / 4e-26 AT5G62950 144 / 8e-45 RNA polymerase II, Rpb4, core protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0426 [flax] [poplar] HRDC-like PF03874 [flax] [poplar] RNA_pol_Rpb4 RNA polymerase Rpb4
Representative CDS sequence Show only first row Show all	>Lus10005329 pacid=23154627 polypeptide=Lus10005329 locus=Lus10005329.g ID=Lus10005329.BGIv1.0 annot-version=v1.0 ATGTTGAAATCAAGAGGTGCTGCCAAGGAAACCAGAGTAATAGCTCCAGTGGCACCTTCCGAATTCAAGGTGTATGATTATTTGGTGGGGACAGTTGCCT GCAATCAGACTAGAGAACACATCAATGAGTTCCTGAAGAAGAGCAAGAAATATAAGATTGCACAATCTGAGATTCTCAATATCATCAACACCAGACCTTC TCAATTGGTGGAACTTCATCTGCTGATAGAGCAACAAGAAGAAGAGATAGAGCAACAAAGACCAGAGTTAGATATGGAGGAACTATTAGAGCTGATCTTG GAAGTTTTGCCACCCCATCCAATTCAGCCTGAACAAGCTGATGAGGCAGCCAAAGAAACTGTTTCTATTGAAGAGGATGAGTAG
AA sequence Show only first row Show all	>Lus10005329 pacid=23154627 polypeptide=Lus10005329 locus=Lus10005329.g ID=Lus10005329.BGIv1.0 annot-version=v1.0 MLKSRGAAKETRVIAPVAPSEFKVYDYLVGTVACNQTREHINEFLKKSKKYKIAQSEILNIINTRPSQLVELHLLIEQQEEEIEQQRPELDMEELLELIL EVLPPHPIQPEQADEAAKETVSIEEDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62950			RNA polymerase II, Rpb4, core ...		Lus10005329 [exp]	0	1
AT5G42520	BBR_BPC	BPC6, BBR/BPC6,...	ARABIDOPSIS THALIANA BASIC PEN...		Lus10024313 [exp]	2.0	0.7706
AT4G10925			Nuclear transport factor 2 (NT...		Lus10001815 [exp]	3.0	0.7535
					Lus10027225 [exp]	5.3	0.7754
AT5G42520	BBR_BPC	BPC6, BBR/BPC6,...	ARABIDOPSIS THALIANA BASIC PEN...		Lus10012389 [exp]	6.3	0.7125
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10039207 [exp]	6.9	0.7496
AT2G20410			RNA-binding ASCH domain protei...		Lus10022016 [exp]	11.0	0.6647
AT2G17240			unknown protein		Lus10043214 [exp]	11.2	0.7195
AT1G62350			Pentatricopeptide repeat (PPR)...		Lus10036049 [exp]	12.4	0.6823
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	18.0	0.7287
AT4G10180		FUS2, DET1, ATD...	FUSCA 2, DE-ETIOLATED 1, light...		Lus10042983 [exp]	19.1	0.6922

Compare expression of checked genes

Lus10005329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.