Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52040 77 / 5e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039586 [exp] 114 / 9e-35 AT3G52040 121 / 1e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G056800 [exp] 84 / 9e-23 AT3G52040 115 / 2e-35 unknown protein Potri.001G262000 [exp] 80 / 3e-21 AT3G52040 118 / 2e-36 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005332 pacid=23154609 polypeptide=Lus10005332 locus=Lus10005332.g ID=Lus10005332.BGIv1.0 annot-version=v1.0 ATGGCAAGGCCCCCAAGATTCGCAAAGGTTCTTGTACGCTGCATCATTTGTGTCGATTGTTTCTACTTTTCTATCGACGATGTTTATCATATTTTGTTTG TATTTGTAGGTAAGAGAAACGCGAAGCCTTCAAAGACGACTTCGGAGATGGATGCGGATAGAGAACTGACCAAATTCATAAACCGCTGCAATGAGGTGAA AGCAGCCACCATGGCAAACAAAGGAGGCGGTCAGCTTAGCATCGTCAAGTCAGATCCTGAACCATCGAATTCTGAGAAGAAGTAG
AA sequence Show only first row Show all	>Lus10005332 pacid=23154609 polypeptide=Lus10005332 locus=Lus10005332.g ID=Lus10005332.BGIv1.0 annot-version=v1.0 MARPPRFAKVLVRCIICVDCFYFSIDDVYHILFVFVGKRNAKPSKTTSEMDADRELTKFINRCNEVKAATMANKGGGQLSIVKSDPEPSNSEKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52040			unknown protein		Lus10005332 [exp]	0	1
AT5G42700	B3		AP2/B3-like transcriptional fa...		Lus10032748 [exp]	2.8	0.7716
AT4G38280			unknown protein		Lus10022622 [exp]	4.2	0.7392
AT1G19240			unknown protein		Lus10034891 [exp]	4.5	0.7555
AT3G52050			5'-3' exonuclease family prote...		Lus10035938 [exp]	6.7	0.7628
AT4G10925			Nuclear transport factor 2 (NT...		Lus10001815 [exp]	7.5	0.7383
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Lus10021074 [exp]	9.0	0.6923
AT4G30845			unknown protein		Lus10002320 [exp]	11.7	0.7854
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	22.0	0.7087
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10041349 [exp]	24.9	0.7473
AT1G15220		ATCCMH	cytochrome c biogenesis protei...		Lus10038941 [exp]	28.9	0.6282

Compare expression of checked genes

Lus10005332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.