Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01420 76 / 2e-17 UGT72B3 UDP-glucosyl transferase 72B3 (.1) AT4G01070 74 / 2e-16 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) AT1G01390 62 / 1e-12 UDP-Glycosyltransferase superfamily protein (.1) AT3G50740 47 / 3e-07 UGT72E1 UDP-glucosyl transferase 72E1 (.1) AT4G36770 45 / 1e-06 UDP-Glycosyltransferase superfamily protein (.1) AT1G07260 43 / 6e-06 UGT71C3 UDP-glucosyl transferase 71C3 (.1) AT5G66690 43 / 9e-06 UGT72E2 UDP-Glycosyltransferase superfamily protein (.1) AT2G29740 42 / 3e-05 UGT71C2 UDP-glucosyl transferase 71C2 (.1) AT2G23250 41 / 5e-05 UGT84B2 UDP-glucosyl transferase 84B2 (.1) AT3G46690 39 / 0.0002 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039588 [exp] 131 / 2e-37 AT4G01070 419 / 2e-143 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10005950 [exp] 77 / 7e-18 AT4G01070 573 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10001905 [exp] 77 / 8e-18 AT1G01420 391 / 3e-132 UDP-glucosyl transferase 72B3 (.1) Lus10029452 [exp] 76 / 2e-17 AT4G01070 582 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10001906 [exp] 72 / 4e-16 AT4G01070 431 / 1e-147 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10003900 [exp] 72 / 7e-16 AT4G01070 411 / 4e-140 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10029453 [exp] 71 / 2e-15 AT4G01070 515 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10005951 [exp] 69 / 9e-15 AT4G01070 510 / 5e-179 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10003897 [exp] 68 / 1e-14 AT4G01070 218 / 1e-67 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G096000 [exp] 81 / 4e-19 AT4G01070 544 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.014G096100 [exp] 71 / 9e-16 AT4G01070 610 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.003G138200 [exp] 71 / 1e-15 AT4G01070 539 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.002G168600 [exp] 68 / 1e-14 AT4G01070 595 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.014G041900 [exp] 59 / 2e-11 AT4G01070 295 / 2e-95 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.007G030400 [exp] 53 / 3e-09 AT3G50740 566 / 0.0 UDP-glucosyl transferase 72E1 (.1) Potri.012G035800 [exp] 48 / 1e-07 AT3G16520 387 / 5e-131 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.017G150100 [exp] 48 / 2e-07 AT3G16520 451 / 9e-156 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.014G041800 [exp] 47 / 2e-07 AT4G01070 390 / 9e-132 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.012G036000 [exp] 47 / 3e-07 AT3G16520 385 / 1e-130 UDP-glucosyl transferase 88A1 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005334 pacid=23154602 polypeptide=Lus10005334 locus=Lus10005334.g ID=Lus10005334.BGIv1.0 annot-version=v1.0 ATGGAGAGCACTGTAAACAGGGTTCCGTTGACTGTGTGGCCTTTGCATGGGGATCAGAAGATGGTGGCGGTTCAGTTGGTTGAGTTTCTCAAAATTGCGT TGAGGCGCAAGGGAGAAGAAGGTGGAAGGGGGATAATTGGGAGGGAAGAGATTGCTAAAGTGGTTAGGGATTTGATGGAAGGGGAAGAATGTGCGGCGTT GAGGAGAAGGATGAGTGAGCTTAAGGAAGCGGCGCTGAATGCAGTGAGTATAGATGGGTATTCTACCAAATCCTTGGAACAGCTTGTGCTTCGATGGAGG AGGAATCCAGTAGAATAA
AA sequence Show only first row Show all	>Lus10005334 pacid=23154602 polypeptide=Lus10005334 locus=Lus10005334.g ID=Lus10005334.BGIv1.0 annot-version=v1.0 MESTVNRVPLTVWPLHGDQKMVAVQLVEFLKIALRRKGEEGGRGIIGREEIAKVVRDLMEGEECAALRRRMSELKEAALNAVSIDGYSTKSLEQLVLRWR RNPVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01420		UGT72B3	UDP-glucosyl transferase 72B3 ...		Lus10005334 [exp]	0	1
AT4G18590			Nucleic acid-binding, OB-fold-...		Lus10022705 [exp]	2.8	0.9074
					Lus10001343 [exp]	4.5	0.9048
AT1G50660			unknown protein		Lus10002072 [exp]	4.6	0.9020
AT3G10520		ATGLB2, ARATHGL...	NON-SYMBIOTIC HAEMOGLOBIN 2, A...		Lus10038655 [exp]	6.0	0.8970
					Lus10028295 [exp]	6.7	0.8864
AT1G01390			UDP-Glycosyltransferase superf...		Lus10005335 [exp]	7.5	0.7352
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10023601 [exp]	7.7	0.8769
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10033564 [exp]	8.5	0.8431
AT2G44060			Late embryogenesis abundant pr...		Lus10019367 [exp]	8.9	0.8500
AT4G26690		GDPDL3, GPDL2, ...	SHAVEN 3, MUTANT ROOT HAIR 5, ...		Lus10043171 [exp]	10.4	0.7806

Compare expression of checked genes

Lus10005334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.