Lus10005335 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01390 92 / 8e-23 UDP-Glycosyltransferase superfamily protein (.1)
AT4G01070 89 / 7e-22 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
AT1G01420 81 / 1e-18 UGT72B3 UDP-glucosyl transferase 72B3 (.1)
AT2G18570 66 / 2e-13 UDP-Glycosyltransferase superfamily protein (.1)
AT5G66690 66 / 2e-13 UGT72E2 UDP-Glycosyltransferase superfamily protein (.1)
AT2G18560 64 / 1e-12 UDP-Glycosyltransferase superfamily protein (.1)
AT5G26310 61 / 1e-11 UGT72E3 UDP-Glycosyltransferase superfamily protein (.1)
AT3G50740 58 / 9e-11 UGT72E1 UDP-glucosyl transferase 72E1 (.1)
AT3G16520 56 / 8e-10 UGT88A1 UDP-glucosyl transferase 88A1 (.1.2.3)
AT3G21760 48 / 4e-07 HYR1 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039588 250 / 1e-82 AT4G01070 419 / 2e-143 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10029452 117 / 1e-31 AT4G01070 582 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10005950 114 / 8e-31 AT4G01070 573 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10029453 94 / 4e-23 AT4G01070 515 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10005951 92 / 1e-22 AT4G01070 510 / 5e-179 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10024037 88 / 6e-21 AT2G18570 412 / 3e-140 UDP-Glycosyltransferase superfamily protein (.1)
Lus10041713 80 / 2e-18 AT2G18570 415 / 3e-141 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003944 72 / 2e-15 AT4G01070 400 / 1e-135 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10001906 69 / 3e-14 AT4G01070 431 / 1e-147 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G168600 102 / 1e-26 AT4G01070 595 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.014G096100 102 / 2e-26 AT4G01070 610 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.014G096000 96 / 6e-24 AT4G01070 544 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.014G041900 87 / 9e-21 AT4G01070 295 / 2e-95 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.007G030500 86 / 3e-20 AT2G18570 494 / 8e-173 UDP-Glycosyltransferase superfamily protein (.1)
Potri.014G041800 80 / 3e-18 AT4G01070 390 / 9e-132 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.003G138200 78 / 1e-17 AT4G01070 539 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.007G030400 77 / 4e-17 AT3G50740 566 / 0.0 UDP-glucosyl transferase 72E1 (.1)
Potri.007G030300 63 / 3e-12 AT3G50740 496 / 1e-173 UDP-glucosyl transferase 72E1 (.1)
Potri.007G029800 63 / 3e-12 AT3G50740 478 / 3e-166 UDP-glucosyl transferase 72E1 (.1)
PFAM info
Representative CDS sequence
>Lus10005335 pacid=23154621 polypeptide=Lus10005335 locus=Lus10005335.g ID=Lus10005335.BGIv1.0 annot-version=v1.0
ATGCCCCATCTCCGCTACGCGATCAGGTCGCTGTCGGAGAAATTTCCTCTATCGTCCTTGATCGCCGACATATTCGGCACCGACGCATTCGACGTGGCCA
GGGAGTTCAAATTGGAGTCGTATTTTTTCGTGACGTTGAACGTTTTGACTCTGGCGCTATGCAACTATATGTCGAAGCTGGATGCCGAGGTTCAAGGGGA
CTACCATCAACTGACCGAACCGATTCGGCTGCCAGGGTTCCGGTTCGTGTTTCCGGTTGAGGACCTGCACCCTTCGATCCTAGACAGGAACATCGATGCT
TACCCGATGCTGCTTCGTCACTCGAGCCGGCAGCGTTTGGCTGACGGGTTTATAGTGAACAGCTTCATGGAGGTGGAAGTAGAGATCATCGAAGCTTTGA
GAGGGTAG
AA sequence
>Lus10005335 pacid=23154621 polypeptide=Lus10005335 locus=Lus10005335.g ID=Lus10005335.BGIv1.0 annot-version=v1.0
MPHLRYAIRSLSEKFPLSSLIADIFGTDAFDVAREFKLESYFFVTLNVLTLALCNYMSKLDAEVQGDYHQLTEPIRLPGFRFVFPVEDLHPSILDRNIDA
YPMLLRHSSRQRLADGFIVNSFMEVEVEIIEALRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01390 UDP-Glycosyltransferase superf... Lus10005335 0 1
AT2G15220 Plant basic secretory protein ... Lus10001358 6.9 0.7845
AT1G01420 UGT72B3 UDP-glucosyl transferase 72B3 ... Lus10005334 7.5 0.7352
AT2G44810 DAD1 DEFECTIVE ANTHER DEHISCENCE 1,... Lus10042914 14.1 0.7476
AT2G25930 PYK20, ELF3 EARLY FLOWERING 3, hydroxyprol... Lus10006857 23.1 0.7264
AT1G14550 Peroxidase superfamily protein... Lus10024206 23.5 0.6501
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10015158 26.4 0.7189
Lus10040397 28.9 0.7189
AT1G76340 GONST3 golgi nucleotide sugar transpo... Lus10034674 30.8 0.6124
AT5G60010 ferric reductase-like transmem... Lus10019390 31.2 0.7189
AT3G53690 RING/U-box superfamily protein... Lus10042610 33.3 0.7189

Lus10005335 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.