Lus10005338 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15920 124 / 9e-34 EMB2782, SMC5 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029476 157 / 4e-45 AT5G15920 1172 / 0.0 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1)
Lus10039590 157 / 6e-45 AT5G15920 1175 / 0.0 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G262600 135 / 2e-37 AT5G15920 1427 / 0.0 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1)
PFAM info
Representative CDS sequence
>Lus10005338 pacid=23154595 polypeptide=Lus10005338 locus=Lus10005338.g ID=Lus10005338.BGIv1.0 annot-version=v1.0
ATGGACAAGAAACTGGAAGCAGATATTGATGAACAGAAGAGGTGTCTTGAAGAAATAGATGAACTGAAAGCAAGCTGGCTTCCCAAGTTGAGAAATCTTG
TTGGTCAGATAAATGGAACTTTCAGTCGGAACTTCCAGGAGATGGCTGTTGCAGGAGAAGTTTCCTTGGGAATGGATCCGATAAATGAAAGGAAGATGTT
TCAACAGCTGGTGAGGGCTACCAGCCAACAAAATACACCGCAGTATTTCTTGGTGACCCCAAAGTTACTGCCGGACCTCGAGTACAGTGAGGCATGCACC
ATTTTGAACATAATGAATGGTCCTTGGATTGATCATCCTTCTGAAGTTTGGAACAGCGGTAACTGTTGGAGTGTTGTGAGAGGGCTTGCTCCTTCCCCCA
TAGCTAGACCACTTCTGAGAGAGGAAGCTCCAACTGAAGGATAA
AA sequence
>Lus10005338 pacid=23154595 polypeptide=Lus10005338 locus=Lus10005338.g ID=Lus10005338.BGIv1.0 annot-version=v1.0
MDKKLEADIDEQKRCLEEIDELKASWLPKLRNLVGQINGTFSRNFQEMAVAGEVSLGMDPINERKMFQQLVRATSQQNTPQYFLVTPKLLPDLEYSEACT
ILNIMNGPWIDHPSEVWNSGNCWSVVRGLAPSPIARPLLREEAPTEG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15920 EMB2782, SMC5 EMBRYO DEFECTIVE 2782, structu... Lus10005338 0 1
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10036603 1.0 0.9734
Lus10000100 1.4 0.9728
AT4G39150 DNAJ heat shock N-terminal dom... Lus10017980 3.5 0.9543
AT3G47570 Leucine-rich repeat protein ki... Lus10037310 4.2 0.9507
AT1G16310 Cation efflux family protein (... Lus10001768 4.6 0.9661
AT1G80170 Pectin lyase-like superfamily ... Lus10026798 6.2 0.9330
AT3G51860 CAX1-LIKE, ATHC... cation exchanger 3 (.1) Lus10018231 10.4 0.9465
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10024685 10.7 0.9445
AT5G17370 Transducin/WD40 repeat-like su... Lus10038394 11.0 0.9327
AT2G46680 HD ATHB7, ATHB-7 ARABIDOPSIS THALIANA HOMEOBOX ... Lus10008840 11.4 0.9581

Lus10005338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.