Lus10005341 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25170 301 / 4e-105 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 265 / 3e-90 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 265 / 5e-85 unknown protein
AT1G80690 247 / 2e-83 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 223 / 3e-73 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 214 / 2e-70 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 209 / 8e-69 PPPDE putative thiol peptidase family protein (.1.2)
AT4G25680 90 / 8e-22 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 89 / 3e-21 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 67 / 2e-13 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041021 372 / 2e-133 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10018326 329 / 5e-116 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 321 / 4e-113 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10042454 238 / 2e-79 AT1G80690 265 / 1e-89 PPPDE putative thiol peptidase family protein (.1)
Lus10026215 236 / 1e-78 AT1G80690 265 / 8e-90 PPPDE putative thiol peptidase family protein (.1)
Lus10032708 228 / 1e-75 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 224 / 3e-74 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040485 223 / 1e-73 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Lus10011291 220 / 1e-72 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G261500 319 / 6e-112 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 305 / 3e-106 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 270 / 1e-92 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 265 / 1e-90 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 233 / 2e-77 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 232 / 2e-77 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 231 / 6e-77 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 228 / 2e-75 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 227 / 3e-75 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 211 / 2e-69 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10005341 pacid=23154624 polypeptide=Lus10005341 locus=Lus10005341.g ID=Lus10005341.BGIv1.0 annot-version=v1.0
ATGTGGTGTCGGATGATCCTGCTGCACCCGAAGAAGAAGACTGGTTCTGTACCGGTTTACTTGAATGTTTATGATTTGACTCCGATGAATGGCTACGCAT
ACTGGTTTGGCCTCGGAATTTACCATTCCGGTGTCCAAGTTCATGGGGTGGAGTATGGTTATGGAGCTCATGACCACTCAACAACGGGGATATTTGAGGT
GGAACCTAGGCAGTGCCCTGGTTTCACTTTCAGGAAGTCAATACTAATTGGAAGGACTGATCTTGGTCCCAAGGAAGTTCGTTCCATGATGGAGAAACTG
TCCCAAGAGTATTCTGGGAATACCTATCATCTTATCACTAAGAACTGCAATCACTTCTGCAACGATGTGTCTCTCAAGTTAACAGGGAAAACAATCCCCA
ACTGGGTTAACCGACTTGCTCGTTTAGGTTTTCTTTGCAACTGTGTGCTGCCAGCTGAGCTGAATGGAGCGAAAGTAAGATCAGAAGAGAGGATGCAGCA
TGTAGAGAAGAAGAAATTAAGGAGCCGTTCAAGTAGATTTGTATCTGCAACTACACCATCATTATCAACAAGTGGTTCTGGTTTGGAAACCAGAAGTGGT
AGGCCCTTAAGAACTAAATGA
AA sequence
>Lus10005341 pacid=23154624 polypeptide=Lus10005341 locus=Lus10005341.g ID=Lus10005341.BGIv1.0 annot-version=v1.0
MWCRMILLHPKKKTGSVPVYLNVYDLTPMNGYAYWFGLGIYHSGVQVHGVEYGYGAHDHSTTGIFEVEPRQCPGFTFRKSILIGRTDLGPKEVRSMMEKL
SQEYSGNTYHLITKNCNHFCNDVSLKLTGKTIPNWVNRLARLGFLCNCVLPAELNGAKVRSEERMQHVEKKKLRSRSSRFVSATTPSLSTSGSGLETRSG
RPLRTK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25170 PPPDE putative thiol peptidase... Lus10005341 0 1
AT3G26935 DHHC-type zinc finger family p... Lus10032009 3.7 0.7782
AT3G51850 CPK13 calcium-dependent protein kina... Lus10004807 9.9 0.7774
AT3G47860 CHL chloroplastic lipocalin (.1) Lus10035734 10.0 0.7815
AT1G69580 GARP Homeodomain-like superfamily p... Lus10037169 12.0 0.7640
AT5G17510 unknown protein Lus10024979 15.8 0.7326
AT3G61880 CYP78A9 cytochrome p450 78a9 (.1.2) Lus10017334 17.7 0.7329
AT3G06740 GATA GATA15 GATA transcription factor 15 (... Lus10037721 18.4 0.7323
AT3G06130 Heavy metal transport/detoxifi... Lus10041228 19.0 0.7734
AT2G46660 CYP78A6 "cytochrome P450, family 78, s... Lus10001670 19.3 0.7533
AT1G56000 FAD/NAD(P)-binding oxidoreduct... Lus10039206 19.7 0.7515

Lus10005341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.