Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02390 72 / 2e-17 GST18, ATGSTZ1 GLUTATHIONE S-TRANSFERASE 18, glutathione S-transferase zeta 1 (.1.2.3) AT2G02380 68 / 6e-16 ATGSTZ2 glutathione S-transferase (class zeta) 2 (.1) AT2G29490 40 / 2e-05 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, glutathione S-transferase TAU 1 (.1) AT2G29480 40 / 2e-05 GST20, ATGSTU2 GLUTATHIONE S-TRANSFERASE 20, glutathione S-transferase tau 2 (.1) AT2G29460 38 / 0.0001 GST22, ATGSTU4 GLUTATHIONE S-TRANSFERASE 22, glutathione S-transferase tau 4 (.1) AT2G29440 38 / 0.0001 GST24, ATGSTU6 GLUTATHIONE S-TRANSFERASE 24, glutathione S-transferase tau 6 (.1) AT1G74590 37 / 0.0001 ATGSTU10 glutathione S-transferase TAU 10 (.1) AT2G29450 37 / 0.0001 ATGSTU1, AT103-1A, ATGSTU5 ARABIDOPSIS THALIANA GLUTATHIONE S-TRANSFERASE TAU 1, glutathione S-transferase tau 5 (.1) AT2G29470 37 / 0.0002 GST21, ATGSTU3 GLUTATHIONE S-TRANSFERASE 21, glutathione S-transferase tau 3 (.1) AT1G59670 37 / 0.0002 ATGSTU15 glutathione S-transferase TAU 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005367 [exp] 108 / 1e-31 AT2G02390 284 / 4e-98 GLUTATHIONE S-TRANSFERASE 18, glutathione S-transferase zeta 1 (.1.2.3) Lus10020519 [exp] 101 / 1e-28 AT2G02390 283 / 2e-97 GLUTATHIONE S-TRANSFERASE 18, glutathione S-transferase zeta 1 (.1.2.3) Lus10030274 [exp] 64 / 3e-14 AT2G02390 249 / 6e-84 GLUTATHIONE S-TRANSFERASE 18, glutathione S-transferase zeta 1 (.1.2.3) Lus10017208 [exp] 44 / 7e-07 AT3G09270 212 / 3e-69 glutathione S-transferase TAU 8 (.1) Lus10016470 [exp] 42 / 4e-06 AT2G29420 166 / 6e-52 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10035241 [exp] 42 / 5e-06 AT2G29420 188 / 5e-60 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10021102 [exp] 41 / 8e-06 AT3G09270 245 / 2e-82 glutathione S-transferase TAU 8 (.1) Lus10016471 [exp] 39 / 5e-05 AT2G29420 234 / 8e-78 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10004026 [exp] 39 / 6e-05 AT2G02390 143 / 6e-44 GLUTATHIONE S-TRANSFERASE 18, glutathione S-transferase zeta 1 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G232600 [exp] 76 / 7e-19 AT2G02390 306 / 2e-106 GLUTATHIONE S-TRANSFERASE 18, glutathione S-transferase zeta 1 (.1.2.3) Potri.014G069600 [exp] 50 / 5e-09 AT2G02390 204 / 1e-66 GLUTATHIONE S-TRANSFERASE 18, glutathione S-transferase zeta 1 (.1.2.3) Potri.016G118500 [exp] 45 / 4e-07 AT2G29420 194 / 3e-62 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061600 [exp] 41 / 7e-06 AT2G29420 172 / 7e-54 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061301 [exp] 41 / 7e-06 AT2G29420 202 / 9e-66 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061800 [exp] 41 / 9e-06 AT2G29420 187 / 1e-59 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.005G037801 [exp] 38 / 6e-05 AT1G78340 197 / 7e-65 glutathione S-transferase TAU 22 (.1) Potri.011G140750 [exp] 37 / 6e-05 AT1G17170 122 / 2e-36 Arabidopsis thaliana Glutathione S-transferase \(class tau\) 24, glutathione S-transferase TAU 24 (.1) Potri.008G174900 [exp] 38 / 9e-05 AT2G29420 184 / 1e-58 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.001G437200 [exp] 38 / 0.0001 AT1G78380 308 / 2e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF02798 [flax] [poplar] GST_N Glutathione S-transferase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10005368 pacid=23148520 polypeptide=Lus10005368 locus=Lus10005368.g ID=Lus10005368.BGIv1.0 annot-version=v1.0 ATGGCATCGAGCGGCGATCATCATGATCGGATCAAGCTCTACTCTTACTGGCGGAGCTCTTGCTCTTGCCGCGTCCGAATTGCTCTCAAGCTCAAAGGGA TTAAGTACGACTATGTTCCCGTTGACTTGGTCAAAGGGGAGCAATCCAGTCCCGGTGAGTACCATCTTGTGCTCATGCAATGA
AA sequence Show only first row Show all	>Lus10005368 pacid=23148520 polypeptide=Lus10005368 locus=Lus10005368.g ID=Lus10005368.BGIv1.0 annot-version=v1.0 MASSGDHHDRIKLYSYWRSSCSCRVRIALKLKGIKYDYVPVDLVKGEQSSPGEYHLVLMQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Lus10005368 [exp]	0	1
AT2G02710		PLPC, PLPB, PLP...	PAS/LOV PROTEIN C, PAS/LOV PRO...		Lus10036711 [exp]	6.3	0.7791
AT1G75220		AtERDL6	ERD6-like 6, Major facilitator...		Lus10002534 [exp]	13.3	0.7599
AT2G48060			unknown protein		Lus10035351 [exp]	16.0	0.6343
AT1G11340			S-locus lectin protein kinase ...		Lus10013247 [exp]	19.6	0.6705
AT4G18490			unknown protein		Lus10034597 [exp]	28.5	0.7187
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Lus10008555 [exp]	29.1	0.7468
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Lus10027577 [exp]	29.2	0.7534
					Lus10025603 [exp]	43.5	0.6885
AT3G01920			DHBP synthase RibB-like alpha/...		Lus10032046 [exp]	50.5	0.6636
AT1G77460			Armadillo/beta-catenin-like re...		Lus10029691 [exp]	57.2	0.6285

Compare expression of checked genes

Lus10005368 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.