Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17615 127 / 2e-35 Disease resistance protein (TIR-NBS class) (.1) AT1G72920 117 / 2e-32 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72940 115 / 5e-31 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72900 113 / 4e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G36930 115 / 6e-30 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27170 115 / 6e-30 transmembrane receptors;ATP binding (.1.2) AT1G72950 112 / 9e-30 Disease resistance protein (TIR-NBS class) (.1) AT1G72930 105 / 3e-29 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72910 108 / 3e-28 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72890 107 / 1e-27 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005373 [exp] 295 / 5e-94 AT5G36930 404 / 8e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020533 [exp] 246 / 8e-76 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10008415 [exp] 222 / 7e-75 AT5G36930 137 / 5e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020524 [exp] 237 / 7e-73 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10020536 [exp] 236 / 2e-72 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10001040 [exp] 216 / 3e-71 AT5G36930 167 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020534 [exp] 233 / 4e-71 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020537 [exp] 233 / 6e-71 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10008027 [exp] 212 / 5e-69 AT5G36930 197 / 5e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G019710 [exp] 150 / 4e-43 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 151 / 1e-42 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 150 / 3e-42 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G014200 [exp] 150 / 5e-42 AT5G36930 673 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 146 / 1e-41 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 148 / 2e-41 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 145 / 2e-41 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G052000 [exp] 147 / 4e-41 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 147 / 4e-41 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G016425 [exp] 146 / 9e-41 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10005374 pacid=23148511 polypeptide=Lus10005374 locus=Lus10005374.g ID=Lus10005374.BGIv1.0 annot-version=v1.0 ATGATGAAATCCGAATATGAGAGCTCCTCCTCCGCGGTGGACCCGTCCATCCTCCCCCGTACACCGGGAGAGTACGAGGTTTTCCTGAGCTTCAGAGGGG GAGATGTCCGCAGAACCTTTGCGGACCATCTCTACAACTACCTTACGGATTTGAAAATCCGCACATTTCGAGATGAGGAAGAGCTCCCGAACGGGGAGTT CATCGCCCAGGCTCTAACCAAAGCTATTACCGAATCCAAGGTCTACGTCCCGATCTTCTCGCGGAACTATGCTGGAAGCAAATGGTGCCTTCAGGAGCTG GCTAAGATGGTGGAGTGCTGGAAGGCCGGGAAGGGAGGAAAAGGACAGCTGATTTTCCTCCCCGTTTTCTATATGATTGATCCGAGAAGCGTGAGGCATT CCACGTCTGAGCCTTACAAGGCGGCGTTCAAAGAACATCGCCGGAAGCATGACGCTCGAACCGTGCCGGCGTGGAAGAAAGCACTCCAAGTGGTTGGTAA AATGAAAGGATGGCACATCACTGAGTTAGATCATGATTCGAGTAGTTAA
AA sequence Show only first row Show all	>Lus10005374 pacid=23148511 polypeptide=Lus10005374 locus=Lus10005374.g ID=Lus10005374.BGIv1.0 annot-version=v1.0 MMKSEYESSSSAVDPSILPRTPGEYEVFLSFRGGDVRRTFADHLYNYLTDLKIRTFRDEEELPNGEFIAQALTKAITESKVYVPIFSRNYAGSKWCLQEL AKMVECWKAGKGGKGQLIFLPVFYMIDPRSVRHSTSEPYKAAFKEHRRKHDARTVPAWKKALQVVGKMKGWHITELDHDSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17615			Disease resistance protein (TI...		Lus10005374 [exp]	0	1
AT4G00120	bHLH	IND1, GT140, bH...	INDEHISCENT, EMBRYO SAC DEVELO...		Lus10033488 [exp]	8.8	0.6179
AT5G42250			Zinc-binding alcohol dehydroge...		Lus10005651 [exp]	10.2	0.6775
					Lus10008694 [exp]	15.6	0.7333
AT5G07050			nodulin MtN21 /EamA-like trans...		Lus10008706 [exp]	17.3	0.6598
AT1G72490			unknown protein		Lus10013160 [exp]	20.8	0.6376
					Lus10008695 [exp]	23.7	0.7083
					Lus10016409 [exp]	24.8	0.5679
AT5G01740			Nuclear transport factor 2 (NT...		Lus10001261 [exp]	26.0	0.6149
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001036 [exp]	34.5	0.5764
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10019789 [exp]	34.6	0.6334

Compare expression of checked genes

Lus10005374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.