Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69550 64 / 3e-12 disease resistance protein (TIR-NBS-LRR class) (.1) AT3G44670 62 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G38340 59 / 2e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G38850 57 / 6e-10 Disease resistance protein (TIR-NBS-LRR class) (.1) AT4G27220 54 / 8e-09 NB-ARC domain-containing disease resistance protein (.1) AT5G58120 53 / 1e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16890 53 / 1e-08 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1) AT3G25510 52 / 2e-08 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G63870 52 / 3e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G38350 52 / 3e-08 Disease resistance protein (NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005373 [exp] 230 / 2e-70 AT5G36930 404 / 8e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020536 [exp] 136 / 2e-37 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10026961 [exp] 135 / 3e-37 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020524 [exp] 135 / 4e-37 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10020537 [exp] 126 / 4e-34 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10020533 [exp] 122 / 9e-33 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10029628 [exp] 94 / 9e-23 AT1G27180 462 / 1e-138 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10020525 [exp] 92 / 2e-22 AT4G16950 66 / 2e-11 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10023272 [exp] 91 / 2e-21 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G030700 [exp] 54 / 9e-09 AT1G69550 602 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.018G135700 [exp] 52 / 5e-08 AT3G14470 380 / 2e-114 NB-ARC domain-containing disease resistance protein (.1) Potri.001G379700 [exp] 50 / 1e-07 AT3G14470 572 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.017G128000 [exp] 50 / 2e-07 AT3G14470 435 / 6e-135 NB-ARC domain-containing disease resistance protein (.1) Potri.007G038900 [exp] 49 / 2e-07 AT5G66900 336 / 4e-108 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.001G261300 [exp] 49 / 3e-07 AT3G14470 538 / 2e-170 NB-ARC domain-containing disease resistance protein (.1) Potri.019G001602 [exp] 49 / 3e-07 AT5G36930 778 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.014G003200 [exp] 49 / 3e-07 AT3G14470 352 / 4e-103 NB-ARC domain-containing disease resistance protein (.1) Potri.007G039100 [exp] 49 / 3e-07 AT5G66900 474 / 3e-156 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.019G002500 [exp] 49 / 4e-07 AT5G17680 587 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10005376 pacid=23148510 polypeptide=Lus10005376 locus=Lus10005376.g ID=Lus10005376.BGIv1.0 annot-version=v1.0 ATGTTGAAACTGGAATCTTTGGTACTTATGGGTACTGAGTTAACCCATGCGGTCCCACCTTCGGTGTCTTTGTTCAACAAACTCGGGAGGCTAGCTTTAT ATAACATGTCGCTTGTGCATTTCCCCGACCTCTCAAATCTCAAGAATTTGAGGGACTTGCGGATTCGATACTGCGAGAAGTTGGTTGAGGTTCCCGGCCT CGATACATTGGTGTTGTTGGAATTCCTGAATATGGAAGGGTGCAAGTTGATTAGGGAATTACAGGGTCTACCGGGTCTCGTGAATTTGAAGACGTTACAA GTTTACGGGTGCAAGCAGTTGACCGAAGTCAGGGGGCTTGGGAGCTTAGAGTCGTTGGAATATTTGGATATGACTGGTTGCAAGTTGATTAGAGAGTTGC CGATTTTATCTGGTCTGAAGATTTTGAAGAAGTTGCAAGTTAAGAAATGTAAAGAGTTGAAGGAGCTGAGAGGGTTTGATAAATTGGAGTCGCTATAA
AA sequence Show only first row Show all	>Lus10005376 pacid=23148510 polypeptide=Lus10005376 locus=Lus10005376.g ID=Lus10005376.BGIv1.0 annot-version=v1.0 MLKLESLVLMGTELTHAVPPSVSLFNKLGRLALYNMSLVHFPDLSNLKNLRDLRIRYCEKLVEVPGLDTLVLLEFLNMEGCKLIRELQGLPGLVNLKTLQ VYGCKQLTEVRGLGSLESLEYLDMTGCKLIRELPILSGLKILKKLQVKKCKELKELRGFDKLESL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G69550			disease resistance protein (TI...		Lus10005376 [exp]	0	1
AT1G25480			Aluminium activated malate tra...		Lus10035037 [exp]	1.7	0.8968
AT3G48670		RDM12, IDN2	RNA-DIRECTED DNA METHYLATION 1...		Lus10002305 [exp]	4.0	0.9042
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015751 [exp]	4.1	0.9054
AT2G40435			unknown protein		Lus10029251 [exp]	5.9	0.8568
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Lus10005447 [exp]	6.6	0.8504
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	7.7	0.8923
					Lus10015620 [exp]	8.1	0.8644
AT2G01520		ZCE1, MLP328	\(Zusammen-CA\)-enhanced 1, ML...		Lus10028887 [exp]	14.7	0.8503
AT1G47271			Cystathionine beta-synthase (C...		Lus10001964 [exp]	15.3	0.8855
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10006716 [exp]	15.7	0.8385

Compare expression of checked genes

Lus10005376 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.