Plant FIBer expression Database

Lus10005377 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38660 56 / 1e-10 APE1 acclimation of photosynthesis to environment (.1.2)
AT5G38650 54 / 1e-10 Proteasome maturation factor UMP1 (.1)
AT1G67250 53 / 3e-10 Proteasome maturation factor UMP1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003077
[exp]
65 / 8e-15 AT5G38660 193 / 1e-64 acclimation of photosynthesis to environment (.1.2)
Lus10034073
[exp]
60 / 9e-13 AT5G38660 197 / 3e-66 acclimation of photosynthesis to environment (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G249600
[exp]
57 / 1e-11 AT1G67250 186 / 7e-62 Proteasome maturation factor UMP1 (.1)
Potri.017G111900
[exp]
52 / 7e-10 AT1G67250 187 / 2e-62 Proteasome maturation factor UMP1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05348 UMP1 Proteasome maturation factor UMP1
Representative CDS sequence
>Lus10005377 pacid=23155601 polypeptide=Lus10005377 locus=Lus10005377.g ID=Lus10005377.BGIv1.0 annot-version=v1.0
ATGTGGATGATGATCGATGGCGGACGACGTCGTTGTTGCCGGAGGGAGGGGAGGAGGATTGAGATTCAAGAGAGGTGGAAGAATGCAAACACTTATGGAT
CCCCCTTCCATGTGAAGATGAATCTGGAAAGAAAACTTCGTACCCGATTTCAGAGTCCACCGGGTGCTATTCCTTCATCAATGCTTGGATTGGAAGTTGC
GGGAGTAAACAGAGCAAGGCAGATCCACGGTGGCTGTTGTTGGCGGGGAAAGTGGAGGAAGTGA
AA sequence
>Lus10005377 pacid=23155601 polypeptide=Lus10005377 locus=Lus10005377.g ID=Lus10005377.BGIv1.0 annot-version=v1.0
MWMMIDGGRRRCCRREGRRIEIQERWKNANTYGSPFHVKMNLERKLRTRFQSPPGAIPSSMLGLEVAGVNRARQIHGGCCWRGKWRK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38650 Proteasome maturation factor U... Lus10005377
[exp]
0 1
Lus10031884
[exp]
1.4 0.9358
AT3G50330 bHLH HEC2, bHLH037 HECATE 2, basic helix-loop-hel... Lus10042647
[exp]
4.0 0.9208
AT1G08570 ACHT4 atypical CYS HIS rich thiored... Lus10015711
[exp]
4.9 0.9026
AT1G75240 ZF_HD ATHB33, ZHD5 zinc-finger homeodomain 5, hom... Lus10031315
[exp]
8.1 0.9172
AT3G54400 Eukaryotic aspartyl protease f... Lus10008654
[exp]
10.7 0.8499
AT2G20520 FLA6 FASCICLIN-like arabinogalactan... Lus10033651
[exp]
15.1 0.8987
AT5G11420 Protein of unknown function, D... Lus10035910
[exp]
15.3 0.9000
AT5G51520 Plant invertase/pectin methyle... Lus10031712
[exp]
17.7 0.8961
AT5G14020 Endosomal targeting BRO1-like ... Lus10012563
[exp]
18.5 0.8896
AT1G75240 ZF_HD ATHB33, ZHD5 zinc-finger homeodomain 5, hom... Lus10031885
[exp]
19.7 0.8853

Lus10005377 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.