Lus10005378 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005378 pacid=23155592 polypeptide=Lus10005378 locus=Lus10005378.g ID=Lus10005378.BGIv1.0 annot-version=v1.0
ATGGATCGCATTCTTCTAGCGTATGTAGGCAGAGCTACAGCTTTAGACATCCATCTGGAAGAGCGTCAACATCTTACGAATGCAGAAGACCTAAGGTACG
TTGAGGAACAACGGATTCTAAATCATCAGAAGTTTAAGCGTGAATGTGTCCTTCTTCTCAAGCGTTATGATGCCCTGGAACGAAGAAGCTTCTGGAGCAA
GATCACCAAGAGGATCATAATACCATCCTTAGCCTCTAGTGTTAGATCATTCTAG
AA sequence
>Lus10005378 pacid=23155592 polypeptide=Lus10005378 locus=Lus10005378.g ID=Lus10005378.BGIv1.0 annot-version=v1.0
MDRILLAYVGRATALDIHLEERQHLTNAEDLRYVEEQRILNHQKFKRECVLLLKRYDALERRSFWSKITKRIIIPSLASSVRSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005378 0 1
Lus10009206 3.0 1.0000
AT4G17260 Lactate/malate dehydrogenase f... Lus10028931 4.0 1.0000
AT2G38300 GARP myb-like HTH transcriptional r... Lus10029225 5.7 1.0000
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10023221 10.2 1.0000
AT1G07985 Expressed protein (.1) Lus10029516 13.4 1.0000
Lus10025806 14.4 1.0000
AT3G11180 2-oxoglutarate (2OG) and Fe(II... Lus10023602 15.2 1.0000
Lus10022996 15.5 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 16.0 1.0000
AT2G19110 ATHMA4, HMA4 ARABIDOPSIS HEAVY METAL ATPASE... Lus10006956 19.2 1.0000

Lus10005378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.