Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024121 [exp] 202 / 4e-63 ND / Lus10029057 [exp] 153 / 1e-44 ND / Lus10005392 [exp] 112 / 6e-30 ND / Lus10024122 [exp] 110 / 2e-29 ND / Lus10022836 [exp] 87 / 7e-21 ND / Lus10040445 [exp] 57 / 2e-10 ND / Lus10038309 [exp] 55 / 1e-09 ND / Lus10023559 [exp] 52 / 8e-09 ND / Lus10040440 [exp] 41 / 1e-05 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G387900 [exp] 81 / 1e-18 ND / Potri.001G388801 [exp] 80 / 1e-18 ND / Potri.001G388450 [exp] 80 / 2e-18 ND / Potri.001G388200 [exp] 79 / 2e-18 ND / Potri.001G388100 [exp] 79 / 5e-18 ND / Potri.001G388600 [exp] 77 / 1e-17 ND / Potri.001G388300 [exp] 76 / 3e-17 ND / Potri.011G047300 [exp] 75 / 8e-17 ND / Potri.011G108300 [exp] 74 / 2e-16 ND / Potri.011G047200 [exp] 70 / 2e-15 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0122 [flax] [poplar] UTRA PF12143 [flax] [poplar] PPO1_KFDV Protein of unknown function (DUF_B2219)
Representative CDS sequence Show only first row Show all	>Lus10005394 pacid=23155600 polypeptide=Lus10005394 locus=Lus10005394.g ID=Lus10005394.BGIv1.0 annot-version=v1.0 ATGGTGCCAAGGCCCAAGACAGGGAGGACTGTGAGGGAGAAGGCCGCGACAAGCGAGATTCTGGTGGTGGAAGGGATCGAGATTCAAGGAGACAGGGTGG TCAATTTCGACGTGGTGGTCAACGACGACCCGGACAACCCGAGCGGACCGTCCAGGGCGGAGTGGGCTGGCAACTTCCTCAACATTCCCCACGTGCATGA ACACGGCGGCAAGAAGTTTGTCGCCGATCTTAGGATGGACATCACTGATCTGCTGGCGGATATTGGTGCTGAAAACGACACCGAGGTGCGTGTGACTTTG GTGCCTAGGAACTCTGATGGTCCACTCTCCATTGCTGGGGTGAGGATTGAGCTCAGTTCTTAG
AA sequence Show only first row Show all	>Lus10005394 pacid=23155600 polypeptide=Lus10005394 locus=Lus10005394.g ID=Lus10005394.BGIv1.0 annot-version=v1.0 MVPRPKTGRTVREKAATSEILVVEGIEIQGDRVVNFDVVVNDDPDNPSGPSRAEWAGNFLNIPHVHEHGGKKFVADLRMDITDLLADIGAENDTEVRVTL VPRNSDGPLSIAGVRIELSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005394 [exp]	0	1
					Lus10005393 [exp]	1.0	0.9948
AT1G06930			unknown protein		Lus10009929 [exp]	2.8	0.9834
					Lus10024615 [exp]	3.5	0.9783
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024616 [exp]	3.5	0.9811
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Lus10036062 [exp]	5.2	0.9694
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10017285 [exp]	5.7	0.9700
AT5G49950			alpha/beta-Hydrolases superfam...		Lus10037322 [exp]	7.6	0.9607
AT5G54370			Late embryogenesis abundant (L...		Lus10033540 [exp]	7.7	0.9753
AT5G62280			Protein of unknown function (D...		Lus10027191 [exp]	9.2	0.9745
AT2G01830		CRE1, AHK4, WOL...	WOODEN LEG 1, WOODEN LEG, CYTO...		Lus10028992 [exp]	10.5	0.9688

Compare expression of checked genes

Lus10005394 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.