Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45690 96 / 6e-26 Protein of unknown function (DUF1264) (.1) AT4G18920 96 / 1e-25 Protein of unknown function (DUF1264) (.1) AT1G05510 81 / 5e-20 Protein of unknown function (DUF1264) (.1) AT1G29680 80 / 8e-20 Protein of unknown function (DUF1264) (.1) AT2G31985 76 / 4e-18 Protein of unknown function (DUF1264) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022586 [exp] 74 / 3e-17 AT1G05510 331 / 6e-116 Protein of unknown function (DUF1264) (.1) Lus10021483 [exp] 43 / 3e-06 AT1G05510 140 / 6e-42 Protein of unknown function (DUF1264) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G148050 [exp] 53 / 9e-11 AT1G05510 0 / 1 Protein of unknown function (DUF1264) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06884 [flax] [poplar] DUF1264 Protein of unknown function (DUF1264)
Representative CDS sequence Show only first row Show all	>Lus10005416 pacid=23182257 polypeptide=Lus10005416 locus=Lus10005416.g ID=Lus10005416.BGIv1.0 annot-version=v1.0 ATGGCGGAGATGGGTGCAAAGAGCAGCATGGAGGGCGGCGGAGAGCCGATCCCGCCGGGAAAGCCGATGTCGATGGAGCAACACATGCTGGACAAAGGAG CCATGATGATGCAGAGCTTGAAGCCCATGAAGCAGATCAGCCAGCACGGCTGCAGCTTCGCGATCTATAGCCACGACATGACTCGCCAGATCGAGACCCA TCACTACTGCACCAGGATCAACCAGGATTTCCTCCAGTGCGCCGTCTACGACTCTGATGGCTCCCACGGCCGCCTCATAGGCTAG
AA sequence Show only first row Show all	>Lus10005416 pacid=23182257 polypeptide=Lus10005416 locus=Lus10005416.g ID=Lus10005416.BGIv1.0 annot-version=v1.0 MAEMGAKSSMEGGGEPIPPGKPMSMEQHMLDKGAMMMQSLKPMKQISQHGCSFAIYSHDMTRQIETHHYCTRINQDFLQCAVYDSDGSHGRLIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45690			Protein of unknown function (D...		Lus10005416 [exp]	0	1
AT1G29680			Protein of unknown function (D...		Lus10005415 [exp]	1.0	0.9868
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10008291 [exp]	4.2	0.9605
AT2G05910			Protein of unknown function (D...		Lus10033432 [exp]	6.5	0.9622
AT3G50120			Plant protein of unknown funct...		Lus10004515 [exp]	7.0	0.9479
AT2G14095			unknown protein		Lus10025500 [exp]	8.4	0.9375
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10016204 [exp]	8.8	0.9387
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10036579 [exp]	10.4	0.9467
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10011979 [exp]	11.8	0.9571
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10005594 [exp]	12.4	0.9312
AT4G37870		PCK1, PEPCK	phosphoenolpyruvate carboxykin...		Lus10028227 [exp]	14.3	0.9521

Compare expression of checked genes

Lus10005416 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.