Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53400 164 / 5e-54 Ubiquitin domain-containing protein (.1) AT5G45740 147 / 2e-47 Ubiquitin domain-containing protein (.1) AT1G16960 133 / 8e-42 Ubiquitin domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015233 [exp] 193 / 2e-65 AT1G53400 199 / 1e-67 Ubiquitin domain-containing protein (.1) Lus10029264 [exp] 176 / 7e-59 AT1G53400 192 / 6e-65 Ubiquitin domain-containing protein (.1) Lus10007315 [exp] 174 / 4e-58 AT1G53400 194 / 8e-66 Ubiquitin domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G107700 [exp] 166 / 1e-54 AT1G53400 172 / 2e-56 Ubiquitin domain-containing protein (.1) Potri.001G387400 [exp] 143 / 1e-45 AT1G53400 182 / 4e-61 Ubiquitin domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005423 pacid=23182252 polypeptide=Lus10005423 locus=Lus10005423.g ID=Lus10005423.BGIv1.0 annot-version=v1.0 ATGGGTTGCGCCGGGTCTTCCTTGGTCAAGGGAGATGGAGGAAATAAGAAGATAAGGAAGCCAAAGCCATGGAAGCATTCCGAACCGATCACAAGGGCAC AGCTCGTGAAGATGCGCGATGAATTCTGGGACACTGCTCCTCATTATGGCGGGCGCAAAGAGATATGGGATGCACTTCGTGTTGCTGCAGAAGCCGAAAT CGGTCTTGCACAGGCCATAGTGGACAGCACTGGTGTCATCGTGCAGAGTGAGGACTTAACGATTTGCTACGACGAGAGAGGTAAAAAAACAGTTTTGTTT CCTTCCTTGCATCCTTGA
AA sequence Show only first row Show all	>Lus10005423 pacid=23182252 polypeptide=Lus10005423 locus=Lus10005423.g ID=Lus10005423.BGIv1.0 annot-version=v1.0 MGCAGSSLVKGDGGNKKIRKPKPWKHSEPITRAQLVKMRDEFWDTAPHYGGRKEIWDALRVAAEAEIGLAQAIVDSTGVIVQSEDLTICYDERGKKTVLF PSLHP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53400			Ubiquitin domain-containing pr...		Lus10005423 [exp]	0	1
AT5G45360			F-box family protein (.1)		Lus10035689 [exp]	1.0	0.8388
AT5G52880			F-box family protein (.1)		Lus10039308 [exp]	3.9	0.8212
AT1G52280		AtRABG3d	RAB GTPase homolog G3D (.1)		Lus10035872 [exp]	5.5	0.8363
AT5G03530		ATRABALPHA, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10014409 [exp]	9.5	0.7807
AT4G27650		PEL1	PELOTA, Eukaryotic release fac...		Lus10009553 [exp]	10.0	0.8077
AT2G45690		PEX16, SSE1, AT...	SHRUNKEN SEED 1, ARABIDOPSIS P...		Lus10036549 [exp]	14.7	0.7933
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Lus10030764 [exp]	16.6	0.7466
					Lus10025480 [exp]	27.3	0.7119
AT2G16090		ATARI2, ARI2, A...	ARABIDOPSIS ARIADNE 2, ARIADNE...		Lus10026319 [exp]	28.2	0.7945
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Lus10029835 [exp]	33.5	0.7872

Compare expression of checked genes

Lus10005423 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.