Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18750 50 / 7e-09 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G57430 45 / 4e-07 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G13770 45 / 5e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G33990 42 / 3e-06 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G27610 42 / 4e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G37170 42 / 5e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G16860 41 / 9e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G46460 41 / 9e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G30700 40 / 2e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G16480 40 / 3e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032688 [exp] 46 / 2e-07 AT2G15690 375 / 2e-124 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040504 [exp] 45 / 3e-07 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013578 [exp] 45 / 5e-07 AT1G16480 1036 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10040917 [exp] 44 / 8e-07 AT4G01030 898 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10019735 [exp] 43 / 2e-06 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029401 [exp] 43 / 2e-06 AT1G34160 674 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008570 [exp] 43 / 2e-06 AT2G15690 375 / 9e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10016387 [exp] 43 / 2e-06 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10033685 [exp] 42 / 4e-06 AT1G16480 962 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G059400 [exp] 57 / 1e-11 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G267100 [exp] 46 / 4e-08 AT5G46460 134 / 6e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G058300 [exp] 47 / 5e-08 AT2G15690 499 / 2e-170 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G068600 [exp] 47 / 6e-08 AT1G16480 1183 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G044700 [exp] 45 / 3e-07 AT3G22690 582 / 0.0 unknown protein Potri.005G215500 [exp] 44 / 1e-06 AT3G63370 922 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G075800 [exp] 44 / 1e-06 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G354400 [exp] 43 / 1e-06 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G155100 [exp] 43 / 1e-06 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G021300 [exp] 42 / 4e-06 AT1G20230 852 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005431 pacid=23182212 polypeptide=Lus10005431 locus=Lus10005431.g ID=Lus10005431.BGIv1.0 annot-version=v1.0 ATGAAGGAAGGAGGCTATACACCAAGGTTGAGATATGCACTGAGGAATGGTGATGATGCTGAGAAGGAAATGGCTCTCTGTGGACACAGTGAGAAGTTAG CTATGGCTTATGCTGAAGTTGCCACCTGGGAAAACAGTGATCAGAGTTTTCAAGAACTTGAGAGTTTGCCGCGACTGTCATGA
AA sequence Show only first row Show all	>Lus10005431 pacid=23182212 polypeptide=Lus10005431 locus=Lus10005431.g ID=Lus10005431.BGIv1.0 annot-version=v1.0 MKEGGYTPRLRYALRNGDDAEKEMALCGHSEKLAMAYAEVATWENSDQSFQELESLPRLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57430		OTP84	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10005431 [exp]	0	1
AT4G25640		FFT, ATDTX35	FLOWER FLAVONOID TRANSPORTER, ...		Lus10027504 [exp]	42.0	0.5609
AT4G15200		AFH3	formin 3 (.1.2)		Lus10031585 [exp]	55.1	0.5268
AT3G18715		IDL4	inflorescence deficient in abs...		Lus10033523 [exp]	106.3	0.5325
AT5G51920			Pyridoxal phosphate (PLP)-depe...		Lus10002958 [exp]	118.1	0.4829
AT1G22450		ATCOX6B2, COX6B	CYTOCHROME C OXIDASE 6B2, cyto...		Lus10020941 [exp]	129.2	0.4926
AT5G27680		RECQSIM	RECQ helicase SIM (.1)		Lus10029898 [exp]	171.6	0.4921
AT3G07820			Pectin lyase-like superfamily ...		Lus10002931 [exp]	182.3	0.4802

Compare expression of checked genes

Lus10005431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.