Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02560 167 / 1e-53 HTA12 histone H2A 12 (.1.2) AT5G59870 159 / 1e-50 HTA6 histone H2A 6 (.1) AT5G27670 154 / 7e-49 HTA7 histone H2A 7 (.1) AT4G27230 133 / 1e-40 HTA2 histone H2A 2 (.1.2) AT1G51060 132 / 1e-40 HTA10 histone H2A 10 (.1) AT1G08880 132 / 2e-40 HTA5 ,G-H2AX ,GAMMA-H2AX ,H2AXA histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) AT1G54690 132 / 3e-40 HTA3 ,G-H2AX ,GAMMA-H2AX ,H2AXB histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) AT3G20670 131 / 5e-40 HTA13 histone H2A 13 (.1) AT5G54640 130 / 8e-40 ATHTA1, HTA1, RAT5 RESISTANT TO AGROBACTERIUM TRANSFORMATION 5, histone H2A 1, Histone superfamily protein (.1) AT2G38810 85 / 1e-21 HTA8 histone H2A 8 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004945 [exp] 199 / 2e-66 AT5G02560 233 / 5e-80 histone H2A 12 (.1.2) Lus10023754 [exp] 184 / 4e-60 AT5G02560 233 / 2e-79 histone H2A 12 (.1.2) Lus10005892 [exp] 165 / 5e-53 AT5G02560 230 / 1e-78 histone H2A 12 (.1.2) Lus10040853 [exp] 164 / 1e-52 AT5G02560 228 / 4e-78 histone H2A 12 (.1.2) Lus10004502 [exp] 142 / 5e-44 AT5G27670 222 / 2e-75 histone H2A 7 (.1) Lus10029899 [exp] 140 / 3e-43 AT5G27670 214 / 3e-72 histone H2A 7 (.1) Lus10028044 [exp] 139 / 5e-43 AT1G08880 238 / 4e-82 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Lus10003750 [exp] 138 / 2e-42 AT1G54690 239 / 7e-83 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10039691 [exp] 134 / 4e-41 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G082300 [exp] 157 / 6e-50 AT5G02560 143 / 2e-44 histone H2A 12 (.1.2) Potri.013G018200 [exp] 148 / 2e-46 AT5G27670 160 / 4e-51 histone H2A 7 (.1) Potri.005G026500 [exp] 143 / 2e-44 AT5G27670 145 / 2e-45 histone H2A 7 (.1) Potri.013G028800 [exp] 137 / 5e-42 AT1G08880 190 / 2e-63 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.013G028900 [exp] 134 / 5e-41 AT1G54690 220 / 4e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040800 [exp] 134 / 6e-41 AT1G54690 221 / 2e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040700 [exp] 133 / 2e-40 AT1G08880 183 / 2e-60 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.011G131400 [exp] 132 / 3e-40 AT1G51060 200 / 1e-67 histone H2A 10 (.1) Potri.001G415700 [exp] 132 / 5e-40 AT1G51060 174 / 1e-56 histone H2A 10 (.1) Potri.004G031300 [exp] 131 / 6e-40 AT1G08880 150 / 6e-48 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10005444 pacid=23182231 polypeptide=Lus10005444 locus=Lus10005444.g ID=Lus10005444.BGIv1.0 annot-version=v1.0 ATGGACGCCGGAACAACCAAAGTTAAGAAGGGAGCCGCCGGCAGGAAAATCGGTGGCCCGAAGAAGAAGCCAGTCTCCAGGTCCCTCAAAGCCGGACTTC AATTCCCCGTCGGAAGAATCGGTCGGTACCTGAAGAAAGGAAGGTACGCTCAGCGAGTTGGCACCGGAGCTCCTGTCTACTTGGCCGCCGTCCTCGAATA TCTCGCCGCTGAAGTTCTTGAGCTGGCGGGAAACGCAGCGCGTGACAACAAGAAGAACAGGATCATCCCGCGCCACGTTCTTCTGGCGATCAGGAACGAC GAGGAGCTAGGAAAGCTGCTGGCCGGAGTGACGATTGCGCACGGCGGTGTTCTCCCGAACATCAACCCGGTGCTGTTGCCGAAGAAGTCAGAGAAAGCTG CCGCCAAGGAACCCGCGGAGAAGAAGGCATCCGCCAAGGCTACCAAGTCCCCCAAGAAAGCTTGA
AA sequence Show only first row Show all	>Lus10005444 pacid=23182231 polypeptide=Lus10005444 locus=Lus10005444.g ID=Lus10005444.BGIv1.0 annot-version=v1.0 MDAGTTKVKKGAAGRKIGGPKKKPVSRSLKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAIRND EELGKLLAGVTIAHGGVLPNINPVLLPKKSEKAAAKEPAEKKASAKATKSPKKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10005444 [exp]	0	1
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10004945 [exp]	2.0	0.9658
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10023754 [exp]	3.0	0.9326
AT4G10890			unknown protein		Lus10001812 [exp]	3.7	0.9394
AT1G66740		AtSP7, SGA2, AS...	ANTI- SILENCING FUNCTION 1A, A...		Lus10017622 [exp]	4.1	0.9246
AT4G03100			Rho GTPase activating protein ...		Lus10024768 [exp]	4.9	0.9394
AT3G07800			Thymidine kinase (.1)		Lus10012347 [exp]	7.0	0.9330
AT5G03870			Glutaredoxin family protein (....		Lus10021353 [exp]	8.0	0.9382
AT1G07820			Histone superfamily protein (....		Lus10015492 [exp]	8.4	0.9317
AT3G18035		HON4	winged-helix DNA-binding trans...		Lus10004328 [exp]	9.5	0.9088
AT5G45700			Haloacid dehalogenase-like hyd...		Lus10007321 [exp]	10.4	0.9350

Compare expression of checked genes

Lus10005444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.