Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59970 162 / 1e-53 Histone superfamily protein (.1) AT5G59690 162 / 1e-53 Histone superfamily protein (.1) AT3G46320 162 / 1e-53 Histone superfamily protein (.1) AT3G53730 162 / 1e-53 Histone superfamily protein (.1) AT3G45930 162 / 1e-53 Histone superfamily protein (.1) AT2G28740 162 / 1e-53 HIS4 histone H4 (.1) AT1G07820 162 / 1e-53 Histone superfamily protein (.1.2) AT1G07660 162 / 1e-53 Histone superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041919 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10019956 [exp] 162 / 1e-53 AT3G46320 199 / 2e-68 Histone superfamily protein (.1) Lus10040849 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10038481 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10014264 [exp] 162 / 1e-53 AT5G59690 199 / 2e-68 Histone superfamily protein (.1) Lus10028464 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10025964 [exp] 162 / 1e-53 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10015492 [exp] 162 / 1e-53 AT1G07820 199 / 2e-68 Histone superfamily protein (.1.2) Lus10004949 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G047500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013300 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G012500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.006G168100 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G214000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G213900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G093000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092666 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10005448 pacid=23182241 polypeptide=Lus10005448 locus=Lus10005448.g ID=Lus10005448.BGIv1.0 annot-version=v1.0 ATGTCTGGCCGCGGCAAGGGAGGAAAGGGACTGGGAAAGGGAGGAGCTAAGAGGCACCGGAAGGTTCTCCGAGACAACATCCAGGGAATCACCAAGCCAG CCATCCGCCGGCTAGCTCGCAGAGGAGGCGTCAAGAGGATTAGCGGACTCATCTACGAGGAGACTCGCGGCGTTCTCAAAATCTTCTTGGAGAATGTCAT CAGAGACGCTGTTACCTACACTGAGCACGCCAGGAGGAAGACCGTCACTGCCATGGATGTCGTCTACGCTCTGAAGAGGCAGGGAAGGACTCTTTACGGT TTCGGTGGTTAG
AA sequence Show only first row Show all	>Lus10005448 pacid=23182241 polypeptide=Lus10005448 locus=Lus10005448.g ID=Lus10005448.BGIv1.0 annot-version=v1.0 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYG FGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28740		HIS4	histone H4 (.1)		Lus10005448 [exp]	0	1
AT2G19730			Ribosomal L28e protein family ...		Lus10006869 [exp]	9.4	0.7305
AT2G05840		PAA2	20S proteasome subunit PAA2 (....		Lus10027669 [exp]	13.4	0.6933
AT2G19080			metaxin-related (.1)		Lus10015535 [exp]	14.3	0.6968
AT4G17085			Putative membrane lipoprotein ...		Lus10029696 [exp]	15.6	0.7026
AT3G27430		PBB1	N-terminal nucleophile aminohy...		Lus10032102 [exp]	18.8	0.6960
AT3G10950			Zinc-binding ribosomal protein...		Lus10006414 [exp]	34.8	0.6812
AT5G02610			Ribosomal L29 family protein ...		Lus10025292 [exp]	44.2	0.6834
AT2G19730			Ribosomal L28e protein family ...		Lus10037609 [exp]	49.9	0.6781
AT1G04190		TPR3	tetratricopeptide repeat 3, Te...		Lus10041189 [exp]	55.3	0.6671
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Lus10003632 [exp]	56.8	0.6534

Compare expression of checked genes

Lus10005448 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.