Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016571 [exp] 50 / 2e-09 ND 36 / 2e-04 Lus10040842 [exp] 45 / 8e-08 ND 37 / 8e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G237700 [exp] 44 / 2e-07 AT5G59305 56 / 5e-12 unknown protein Potri.009G029000 [exp] 38 / 0.0001 AT5G59305 51 / 2e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005454 pacid=23182203 polypeptide=Lus10005454 locus=Lus10005454.g ID=Lus10005454.BGIv1.0 annot-version=v1.0 ATGAGTAGCAGCAAGCTTCTGCAAATTTCCCTGCTCTTAGCATTGCTATTCGTCGCTTCTCGACATGGTCTCCTCGTCGATGCCAAGGATCAACCAGCTA CTGCTACAGAGCAATTCAGAGTCAATCTGGCAAGTTCCTCCAGGAAACAGTACAGAAAAGCATCCTGGAAATGGCAACAGAGCCAGGTTGGATCGAAGAG GGTGCGAAAAGCTCCGTCGGGGCCGAACCCTGTTGGCAATCACAGTCCACCTACAAAGCAATAG
AA sequence Show only first row Show all	>Lus10005454 pacid=23182203 polypeptide=Lus10005454 locus=Lus10005454.g ID=Lus10005454.BGIv1.0 annot-version=v1.0 MSSSKLLQISLLLALLFVASRHGLLVDAKDQPATATEQFRVNLASSSRKQYRKASWKWQQSQVGSKRVRKAPSGPNPVGNHSPPTKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005454 [exp]	0	1
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10004048 [exp]	1.4	0.9265
AT3G20640	bHLH	bHLH123	basic helix-loop-helix (bHLH) ...		Lus10038550 [exp]	2.4	0.9162
AT5G48740			Leucine-rich repeat protein ki...		Lus10038172 [exp]	4.9	0.9064
AT5G46220			Protein of unknown function (D...		Lus10038497 [exp]	5.3	0.9168
AT3G59110			Protein kinase superfamily pro...		Lus10029788 [exp]	10.7	0.9066
AT1G77170			Tetratricopeptide repeat (TPR)...		Lus10020657 [exp]	12.1	0.8824
AT3G59530		LAP3	LESS ADHERENT POLLEN 3, Calciu...		Lus10008151 [exp]	12.3	0.9120
AT3G08500	MYB	ATMYB83	myb domain protein 83 (.1)		Lus10019707 [exp]	17.0	0.8865
AT5G01180		ATPTR5	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10035516 [exp]	17.4	0.9044
AT3G54000			unknown protein		Lus10017206 [exp]	21.6	0.8374

Compare expression of checked genes

Lus10005454 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.