Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59350 40 / 5e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040839 [exp] 53 / 3e-09 AT5G59350 160 / 2e-47 unknown protein Lus10016568 [exp] 52 / 5e-09 AT5G59350 166 / 1e-49 unknown protein Lus10023421 [exp] 38 / 0.0007 AT5G59350 115 / 2e-30 unknown protein Lus10040302 [exp] 37 / 0.0008 AT5G59350 117 / 3e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G238300 [exp] 52 / 5e-09 AT5G59350 146 / 1e-41 unknown protein Potri.009G029300 [exp] 48 / 1e-07 AT5G59350 161 / 1e-47 unknown protein Potri.008G054400 [exp] 43 / 9e-06 AT5G59350 91 / 8e-21 unknown protein Potri.010G206100 [exp] 43 / 1e-05 AT5G59350 111 / 1e-28 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005455 pacid=23182238 polypeptide=Lus10005455 locus=Lus10005455.g ID=Lus10005455.BGIv1.0 annot-version=v1.0 ATGAAATCCGGCGGTGGGTTAGTAATCGGATTGAGTTTCGTGTTCAGTTTCCTCATCCTTGCACTCGTCGCTAACCTTTATTATTTCCTATGCTGGAAGA AGAAGAAGCGAATCATCAACATCCGCCGCATCGAAGAAGAAGAAGATTTAGAAAACGGCAAAGATTACTACGCCGCCGTTACTGGTAAATACGCCAAGGA ATTGTTCCATCTCGTCTGCTGGAAAAACCCGCCCACCACCGCCAGACCCGACGCGGAATACGGCGCCGCCGCCGGAAGAGCGGAGGAGNNNNGGAGGAGC GGAGGAGAGCGTTGA
AA sequence Show only first row Show all	>Lus10005455 pacid=23182238 polypeptide=Lus10005455 locus=Lus10005455.g ID=Lus10005455.BGIv1.0 annot-version=v1.0 MKSGGGLVIGLSFVFSFLILALVANLYYFLCWKKKKRIINIRRIEEEEDLENGKDYYAAVTGKYAKELFHLVCWKNPPTTARPDAEYGAAAGRAEEXXRS GGER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59350			unknown protein		Lus10005455 [exp]	0	1
AT5G59350			unknown protein		Lus10005456 [exp]	1.0	0.9012
AT4G36520			Chaperone DnaJ-domain superfam...		Lus10028322 [exp]	8.5	0.7307
AT5G12470			Protein of unknown function (D...		Lus10003180 [exp]	16.3	0.7511
AT3G24860	Trihelix		Homeodomain-like superfamily p...		Lus10022789 [exp]	17.5	0.7009
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028469 [exp]	17.9	0.7223
AT4G12610		RAP74, ATRAP74	transcription activators;DNA b...		Lus10017289 [exp]	24.7	0.6653
AT1G06780		GAUT6	galacturonosyltransferase 6 (....		Lus10014750 [exp]	25.2	0.6049
AT5G01090			Concanavalin A-like lectin fam...		Lus10021117 [exp]	26.1	0.7453
AT4G23500			Pectin lyase-like superfamily ...		Lus10017517 [exp]	28.6	0.7112
AT5G44730			Haloacid dehalogenase-like hyd...		Lus10001353 [exp]	30.0	0.7144

Compare expression of checked genes

Lus10005455 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.