Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25360 100 / 5e-28 unknown protein AT1G15350 77 / 7e-20 unknown protein AT3G15770 74 / 6e-18 unknown protein AT4G32342 69 / 4e-16 unknown protein AT3G54880 62 / 1e-13 unknown protein AT5G03440 59 / 5e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030101 [exp] 80 / 1e-21 AT5G25360 79 / 2e-20 unknown protein Lus10002164 [exp] 77 / 4e-19 AT5G25360 174 / 3e-56 unknown protein Lus10013824 [exp] 64 / 1e-14 AT3G54880 108 / 1e-31 unknown protein Lus10026537 [exp] 60 / 2e-13 AT5G03440 97 / 5e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G254000 [exp] 112 / 5e-33 AT5G25360 197 / 3e-65 unknown protein Potri.018G027800 [exp] 111 / 2e-32 AT5G25360 182 / 1e-58 unknown protein Potri.001G192700 [exp] 87 / 2e-23 AT5G25360 169 / 1e-54 unknown protein Potri.006G068600 [exp] 78 / 2e-19 AT5G25360 194 / 9e-64 unknown protein Potri.018G130900 [exp] 70 / 3e-16 AT5G25360 140 / 8e-43 unknown protein Potri.010G227800 [exp] 67 / 5e-16 AT3G54880 123 / 7e-38 unknown protein Potri.008G034600 [exp] 66 / 2e-15 AT3G54880 120 / 8e-37 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005466 pacid=23174339 polypeptide=Lus10005466 locus=Lus10005466.g ID=Lus10005466.BGIv1.0 annot-version=v1.0 ATGGACAACAGCACTCTACAATCACAGAGAAGCATGTCTTCAATCAGCACACTGAACCAGCCCCTAGGTCCCTACAGTAATATTGGCAGCACAAGCCACC CCGCTGAATTCCTCTCAATTGACGCAGACAATGCTGCTGCGTGTTTCAGTTGGAATGTTACTTATGAGAGCTTATTGGGCAGTAATAAGCCTTTCCCCCG TCCTGTTCCCCTTGCTGAAATGGTGGATTTTCTAGTGGACGTTTGGGAACAGGAAGGATTGTATGACTGA
AA sequence Show only first row Show all	>Lus10005466 pacid=23174339 polypeptide=Lus10005466 locus=Lus10005466.g ID=Lus10005466.BGIv1.0 annot-version=v1.0 MDNSTLQSQRSMSSISTLNQPLGPYSNIGSTSHPAEFLSIDADNAAACFSWNVTYESLLGSNKPFPRPVPLAEMVDFLVDVWEQEGLYD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25360			unknown protein		Lus10005466 [exp]	0	1
AT5G49530			SIN-like family protein (.1)		Lus10041724 [exp]	15.4	0.7924
AT4G35750			SEC14 cytosolic factor family ...		Lus10005640 [exp]	34.2	0.7702
AT3G19860	bHLH	bHLH121	basic Helix-Loop-Helix 121, ba...		Lus10041908 [exp]	35.5	0.7491
AT4G36730	bZIP	GBF1	G-box binding factor 1 (.1.2)		Lus10041720 [exp]	37.0	0.7793
AT3G24060			Plant self-incompatibility pro...		Lus10023675 [exp]	37.7	0.7623
AT5G41790		CIP1	COP1-interactive protein 1 (.1...		Lus10032362 [exp]	40.5	0.7178
AT2G45500			AAA-type ATPase family protein...		Lus10038001 [exp]	42.4	0.7733
AT3G48530		KING1	SNF1-related protein kinase re...		Lus10016763 [exp]	43.7	0.7799
AT4G10730			Protein kinase superfamily pro...		Lus10017326 [exp]	47.1	0.7624
AT3G07370		ATCHIP, CHIP	carboxyl terminus of HSC70-int...		Lus10020412 [exp]	54.3	0.7409

Compare expression of checked genes

Lus10005466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.