Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005472 [exp] 121 / 2e-37 ND / Lus10017834 [exp] 92 / 3e-25 ND / Lus10012388 [exp] 86 / 7e-23 ND / Lus10022156 [exp] 84 / 2e-21 ND / Lus10043004 [exp] 83 / 1e-20 ND 47 / 8e-06 Lus10010602 [exp] 77 / 6e-20 ND 35 / 0.010 Lus10018996 [exp] 79 / 2e-19 ND / Lus10019612 [exp] 72 / 6e-18 ND / Lus10005607 [exp] 73 / 1e-17 ND 38 / 0.003
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005473 pacid=23174345 polypeptide=Lus10005473 locus=Lus10005473.g ID=Lus10005473.BGIv1.0 annot-version=v1.0 ATGTGGAAAGACCAAGTGTTGAAGAATGATAAGATCCCAAAAGCACTCTCTTCAAAAGCTTCTAGAGCATCTTGTATTACAGCCAAGCCTAGACAGATTC CAATACTGATATGGACACAATTTATGGACTGCAAGCTGAGACCAGAAGTTCTGGTAATAGCTAAGAAGAAGGCTGCAAACGGGGCTATTTTTGATGCACC ACACACTGGTGGCTCAAAGTTGTAG
AA sequence Show only first row Show all	>Lus10005473 pacid=23174345 polypeptide=Lus10005473 locus=Lus10005473.g ID=Lus10005473.BGIv1.0 annot-version=v1.0 MWKDQVLKNDKIPKALSSKASRASCITAKPRQIPILIWTQFMDCKLRPEVLVIAKKKAANGAIFDAPHTGGSKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005473 [exp]	0	1
					Lus10000578 [exp]	1.0	0.8718
					Lus10035602 [exp]	2.8	0.8210
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10000045 [exp]	23.2	0.8280
AT4G31115			Protein of unknown function (D...		Lus10018151 [exp]	26.9	0.7532
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10023560 [exp]	28.3	0.8238
AT1G30825		DIS2, ARPC2, AR...	DISTORTED TRICHOMES 2, ACTIN-R...		Lus10002867 [exp]	29.2	0.7904
AT1G65680		ATHEXPBETA1.4, ...	expansin B2 (.1)		Lus10027223 [exp]	41.3	0.7851
AT5G03490			UDP-Glycosyltransferase superf...		Lus10019201 [exp]	48.0	0.8170
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10026816 [exp]	58.9	0.7897
AT3G47570			Leucine-rich repeat protein ki...		Lus10017028 [exp]	63.6	0.7476

Compare expression of checked genes

Lus10005473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.