Lus10005477 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G25770 171 / 3e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT4G32870 134 / 7e-41 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026898 218 / 4e-74 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10000573 124 / 1e-36 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10006042 121 / 1e-35 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10028262 76 / 6e-18 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040227 77 / 9e-18 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040916 39 / 0.0005 AT1G01360 265 / 1e-91 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G046100 204 / 3e-68 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.006G236800 142 / 5e-43 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237000 140 / 6e-43 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237100 134 / 2e-40 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G063900 76 / 6e-18 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G193200 52 / 3e-09 AT2G25770 59 / 4e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Lus10005477 pacid=23182564 polypeptide=Lus10005477 locus=Lus10005477.g ID=Lus10005477.BGIv1.0 annot-version=v1.0
ATGGCAGAAGAAGCCCAAACCAAATGGAATGGAAAGGTCCGGGCAAACGTAAAGAGAGCCAGCGCCGACCAGATATGGACGCTCTTCACAGATTTCTTCA
ACATTCACAGATGGTTCCCAACCCTTCCATCCAGCTACGGAATCCACGGCACCAATGGCCAACCGGGCTGCATCCGCTACTGCTCGGGCTTCACCCTTCC
CTCTACCCAGCTTCTTAGCTGGTCCAAGGAGAGATTGACCGCCGTCGATCACTCCCGCCGATGTCTCACCTACGAGATTGTCGACTGCAACATCGGATTC
AAGTCCTATACATCAACAGTCCAGATTTTTCCGGGTGATGATGATGATGGCCAAGGATGTTTGATCGAGTGGGGGTTCACGGTAGATCCCGTGGAAGGAT
GGGTACTGGATGTTCTGGTGGAGAAGTATGAAACGGTGTTGAATGCTGCAGCCCGCAAAATGGAGGAGGAGGTCATTGGATCCATTTGA
AA sequence
>Lus10005477 pacid=23182564 polypeptide=Lus10005477 locus=Lus10005477.g ID=Lus10005477.BGIv1.0 annot-version=v1.0
MAEEAQTKWNGKVRANVKRASADQIWTLFTDFFNIHRWFPTLPSSYGIHGTNGQPGCIRYCSGFTLPSTQLLSWSKERLTAVDHSRRCLTYEIVDCNIGF
KSYTSTVQIFPGDDDDGQGCLIEWGFTVDPVEGWVLDVLVEKYETVLNAAARKMEEEVIGSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G25770 Polyketide cyclase/dehydrase a... Lus10005477 0 1
AT5G43180 Protein of unknown function, D... Lus10025134 8.2 0.6803
AT2G39705 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 ... Lus10002705 23.3 0.6576
Lus10017454 30.9 0.6422
AT3G50660 PSC1, CYP90B1, ... SUPPRESSOR OF NPH4 2, SHADE AV... Lus10041738 44.0 0.6033
AT3G07020 UGT80A2, SGT UDP-glucosyl transferase 80A2,... Lus10011882 52.9 0.6248
AT1G60780 HAP13 HAPLESS 13, Clathrin adaptor c... Lus10004626 55.4 0.6175
AT5G37790 Protein kinase superfamily pro... Lus10009125 104.4 0.5551
AT5G62580 ARM repeat superfamily protein... Lus10033129 116.0 0.5601
AT5G46150 LEM3 (ligand-effect modulator ... Lus10038516 174.0 0.5183
AT2G38020 EMB258, MAN, VC... VACUOLELESS 1, MANGLED, vacuol... Lus10011325 225.6 0.5176

Lus10005477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.