Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65920 111 / 4e-30 ARM repeat superfamily protein (.1) AT3G49810 110 / 2e-29 ARM repeat superfamily protein (.1) AT3G54850 71 / 3e-15 ATPUB14 plant U-box 14 (.1) AT5G42340 68 / 2e-14 PUB15 Plant U-Box 15 (.1) AT3G19380 67 / 5e-14 PUB25 plant U-box 25 (.1) AT3G18710 66 / 9e-14 ATPUB29 ARABIDOPSIS THALIANA PLANT U-BOX 29, plant U-box 29 (.1) AT1G23030 66 / 2e-13 PUB11 ARM repeat superfamily protein (.1) AT1G49780 65 / 2e-13 PUB26 plant U-box 26 (.1) AT3G46510 65 / 2e-13 ATPUB13 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1) AT5G64660 64 / 3e-13 ATCMPG2 "CYS, MET, PRO, and GLY protein 2", CYS, MET, PRO, and GLY protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012491 [exp] 166 / 2e-52 AT5G65920 180 / 1e-53 ARM repeat superfamily protein (.1) Lus10010598 [exp] 122 / 3e-34 AT3G49810 498 / 6e-176 ARM repeat superfamily protein (.1) Lus10043471 [exp] 72 / 1e-15 AT1G71020 682 / 0.0 ARM repeat superfamily protein (.1.2) Lus10034113 [exp] 71 / 2e-15 AT3G59770 1913 / 0.0 ARABIDOPSIS THALIANA SUPPRESSOR OF ACTIN 9, sacI homology domain-containing protein / WW domain-containing protein (.1.2.3) Lus10037970 [exp] 67 / 3e-14 AT3G54850 803 / 0.0 plant U-box 14 (.1) Lus10038699 [exp] 67 / 6e-14 AT3G54850 599 / 0.0 plant U-box 14 (.1) Lus10042798 [exp] 67 / 8e-14 AT3G18710 275 / 9e-89 ARABIDOPSIS THALIANA PLANT U-BOX 29, plant U-box 29 (.1) Lus10012260 [exp] 66 / 1e-13 AT5G42340 695 / 0.0 Plant U-Box 15 (.1) Lus10030628 [exp] 66 / 2e-13 AT1G60190 553 / 0.0 plant U-box 19, ARM repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G116600 [exp] 122 / 3e-34 AT3G49810 546 / 0.0 ARM repeat superfamily protein (.1) Potri.014G014300 [exp] 121 / 7e-34 AT3G49810 553 / 0.0 ARM repeat superfamily protein (.1) Potri.006G277700 [exp] 117 / 4e-32 AT3G49810 498 / 3e-175 ARM repeat superfamily protein (.1) Potri.002G116500 [exp] 117 / 4e-32 AT3G49810 556 / 0.0 ARM repeat superfamily protein (.1) Potri.005G063700 [exp] 73 / 3e-16 AT1G49780 139 / 3e-37 plant U-box 26 (.1) Potri.007G105300 [exp] 72 / 1e-15 AT1G49780 157 / 8e-44 plant U-box 26 (.1) Potri.010G113900 [exp] 69 / 8e-15 AT1G23030 732 / 0.0 ARM repeat superfamily protein (.1) Potri.010G226500 [exp] 67 / 3e-14 AT3G54850 806 / 0.0 plant U-box 14 (.1) Potri.008G035700 [exp] 67 / 5e-14 AT3G54850 821 / 0.0 plant U-box 14 (.1) Potri.004G061800 [exp] 67 / 6e-14 AT1G29340 833 / 0.0 ARABIDOPSIS THALIANA PLANT U-BOX 17, plant U-box 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [flax] [poplar] RING PF04564 [flax] [poplar] U-box U-box domain
Representative CDS sequence Show only first row Show all	>Lus10005500 pacid=23182553 polypeptide=Lus10005500 locus=Lus10005500.g ID=Lus10005500.BGIv1.0 annot-version=v1.0 ATGGCGATGAATCGACGGAGAAAAGACGCAACCCTTTTGGGGCTGGATGTTGGTGGGCAAGTCTTAGATCTCGAAACCGCTGTAAAAGACGGCATTCTGG GCGGCGGCGGTGGTGAAAGTGGAGGAGGGTTCATTACTTGCGCCTCGTCGGATAAATTAGATCTGAAGAAAATGATTGAGGAGCTTGAATCAGTTCAAGT GCCTTCCGTATTCATCTGCCCAATCTCGCTGGAACCCATGCGAGACCCAGTGACCCTCTGCACTGGACAGACATACGAGAGATCCAACATCATGAAATGG TTCTCAATGGGACACTACACTTGCCCCACCAAGCTTTCATATACATAA
AA sequence Show only first row Show all	>Lus10005500 pacid=23182553 polypeptide=Lus10005500 locus=Lus10005500.g ID=Lus10005500.BGIv1.0 annot-version=v1.0 MAMNRRRKDATLLGLDVGGQVLDLETAVKDGILGGGGGESGGGFITCASSDKLDLKKMIEELESVQVPSVFICPISLEPMRDPVTLCTGQTYERSNIMKW FSMGHYTCPTKLSYT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G65920			ARM repeat superfamily protein...		Lus10005500 [exp]	0	1
AT1G71060			Tetratricopeptide repeat (TPR)...		Lus10001633 [exp]	7.1	0.8411
AT2G02150		EMB2794	EMBRYO DEFECTIVE 2794, Tetratr...		Lus10034421 [exp]	7.6	0.8444
AT3G23780		NRPE2, DMS2, DR...	DEFECTIVE IN MERISTEM SILENCIN...		Lus10027166 [exp]	13.9	0.8471
AT5G37570			Pentatricopeptide repeat (PPR-...		Lus10022701 [exp]	15.5	0.8094
AT3G48810			Pentatricopeptide repeat (PPR)...		Lus10009023 [exp]	18.7	0.7984
AT1G71260		WHY2, ATWHY2	WHIRLY 2 (.1)		Lus10035067 [exp]	22.5	0.7906
AT3G63430			unknown protein		Lus10018750 [exp]	22.8	0.8321
AT5G43990		SDG18, SUVR2	SET DOMAIN PROTEIN 18, SET-dom...		Lus10022879 [exp]	26.9	0.8249
AT2G28070		ABCG3	ATP-binding cassette G3, ABC-2...		Lus10041333 [exp]	27.1	0.8176
AT5G44370		PHT4;6	phosphate transporter 4;6 (.1)		Lus10013836 [exp]	32.7	0.7678

Compare expression of checked genes

Lus10005500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.