Lus10005512 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012439 139 / 3e-42 ND /
Lus10004993 70 / 2e-14 ND /
Lus10022099 42 / 5e-05 ND /
Lus10021760 41 / 0.0001 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005512 pacid=23177345 polypeptide=Lus10005512 locus=Lus10005512.g ID=Lus10005512.BGIv1.0 annot-version=v1.0
ATGGACGGGGTACACAATAACAACAACAACATCCGTAACAACAACCCCAACAACAACCACAACGATAACCGCAACAATAACCACACCAACAATCACAATC
ATGAGGATGGGCACCACAACAATAAGAATAATGAAAATTTTATTCTCATTCTTCACGAGAAGCGATTGATAGCTTATGGCCGTCCTACTCTCGGAGGAGC
TGCTTCAAGCATTCAATCTCCAATCAGAGGAGATCAAGCTTATCAAACTCCAATGCCCCTAATTAACATCATTCAATCAAGGGCATTCTCTAGAGCACCG
GGAGAAAACCCAAATGCTCATCTCAGCGATTTCGTTCATCTAGCTGAGACGAATAGAGCAAGAGGAGTAAATATTGATGAACTCAAGCTTAGCCTATTTG
CATTTTCTCTAAAGGGGGATGCATTGGAATGGTTGTACGAGCATCAAGTACCTACCCACCACCCTTCAAAGAATGCGTAA
AA sequence
>Lus10005512 pacid=23177345 polypeptide=Lus10005512 locus=Lus10005512.g ID=Lus10005512.BGIv1.0 annot-version=v1.0
MDGVHNNNNNIRNNNPNNNHNDNRNNNHTNNHNHEDGHHNNKNNENFILILHEKRLIAYGRPTLGGAASSIQSPIRGDQAYQTPMPLINIIQSRAFSRAP
GENPNAHLSDFVHLAETNRARGVNIDELKLSLFAFSLKGDALEWLYEHQVPTHHPSKNA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005512 0 1
AT3G06240 F-box family protein (.1) Lus10011015 4.5 0.7503
AT1G26380 FAD-binding Berberine family p... Lus10023374 4.9 0.7014
AT1G01970 Tetratricopeptide repeat (TPR)... Lus10015865 6.9 0.6399
AT1G70520 ASG6, CRK2 ALTERED SEED GERMINATION 6, cy... Lus10020834 11.2 0.6634
AT1G18440 Peptidyl-tRNA hydrolase family... Lus10042977 14.7 0.6784
AT2G20540 MEF21 mitochondrial editing factor ... Lus10007684 20.3 0.5329
Lus10001901 31.3 0.6854
AT5G53840 F-box/RNI-like/FBD-like domain... Lus10014161 32.2 0.5819
AT5G51070 SAG15, CLPD, ER... SENESCENCE ASSOCIATED GENE 15,... Lus10012953 34.1 0.6825
Lus10031595 43.3 0.6540

Lus10005512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.