Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027875 [exp] 36 / 0.0006 AT4G34150 246 / 3e-82 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005514 pacid=23177348 polypeptide=Lus10005514 locus=Lus10005514.g ID=Lus10005514.BGIv1.0 annot-version=v1.0 ATGAAACAACTCGAAGGCGTATTCTCAACCACGACAATGGAGGATTCAACATCTTGTACAACTCCGCAACTAGAAAGGGATGGAGATGATGTTGCAGCTA TTACAAACCTTGACGATTGTGTTCTAACTGGCAACTGCTCCACTGTAAATGTTTATACATCTTATATGGATTGTTGCTGA
AA sequence Show only first row Show all	>Lus10005514 pacid=23177348 polypeptide=Lus10005514 locus=Lus10005514.g ID=Lus10005514.BGIv1.0 annot-version=v1.0 MKQLEGVFSTTTMEDSTSCTTPQLERDGDDVAAITNLDDCVLTGNCSTVNVYTSYMDCC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005514 [exp]	0	1
					Lus10000529 [exp]	1.0	1.0000
AT5G05070			DHHC-type zinc finger family p...		Lus10027274 [exp]	1.4	1.0000
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Lus10014005 [exp]	1.7	1.0000
AT3G02960			Heavy metal transport/detoxifi...		Lus10015762 [exp]	2.2	1.0000
AT3G60730			Plant invertase/pectin methyle...		Lus10015877 [exp]	2.8	1.0000
AT2G04865			Aminotransferase-like, plant m...		Lus10014633 [exp]	2.8	1.0000
AT1G66350	GRAS	RGL1	RGA-like 1 (.1)		Lus10016888 [exp]	3.0	1.0000
AT4G17920			RING/U-box superfamily protein...		Lus10035368 [exp]	3.5	1.0000
AT5G27260			unknown protein		Lus10007175 [exp]	3.5	1.0000
AT1G61320			FBD / Leucine Rich Repeat doma...		Lus10010664 [exp]	3.6	1.0000

Compare expression of checked genes

Lus10005514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.