Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06135 41 / 9e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006567 [exp] 174 / 1e-57 ND 35 / 0.001 Lus10041164 [exp] 61 / 4e-13 ND 34 / 0.002 Lus10024873 [exp] 47 / 1e-07 ND 37 / 2e-04 Lus10024872 [exp] 45 / 5e-07 ND 39 / 3e-05 Lus10014739 [exp] 40 / 4e-05 ND 40 / 2e-05 Lus10041163 [exp] 39 / 0.0001 ND 34 / 0.002 Lus10000703 [exp] 37 / 0.0006 AT1G06135 44 / 3e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G043600 [exp] 76 / 7e-19 AT1G06135 39 / 3e-05 unknown protein Potri.019G013000 [exp] 59 / 3e-12 AT2G31335 / unknown protein Potri.019G012700 [exp] 57 / 2e-11 AT2G31335 / unknown protein Potri.019G012400 [exp] 54 / 2e-10 AT2G31335 / unknown protein Potri.008G163000 [exp] 54 / 3e-10 AT2G31335 40 / 1e-05 unknown protein Potri.008G162900 [exp] 50 / 7e-09 AT2G31335 / unknown protein Potri.019G012603 [exp] 49 / 1e-08 AT2G31335 / unknown protein Potri.008G160650 [exp] 47 / 6e-08 AT2G31335 / unknown protein Potri.002G041950 [exp] 47 / 1e-07 AT2G31335 / unknown protein Potri.019G012601 [exp] 47 / 1e-07 AT2G31335 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005525 pacid=23158843 polypeptide=Lus10005525 locus=Lus10005525.g ID=Lus10005525.BGIv1.0 annot-version=v1.0 ATGGATTCTGCAAAAGTCGGCAGCTTTTCAGCGACCAGATCAGTAACAGCGTCGGTAATGCTCGTGGCCGTTTTACTAATGGCGTCGTGCTATCGGGAAA CAGCGGCGGCAAGGCCGCTTTTGGAGATAAACATCCAGTCGTTACAGAGGGGACCGGTGCCGTCGTCCAAATCGTCGCCGTGCGGCCACGTGCCCAACCG CGGGACTGGAAAATGCACATTGGCTGGGATGAACGTCGCCGGAGAGGGTCTCCGTGTTCGATCTCCTCCGGCGCCGGTGGTGGCGCATCCGGTGGCTGAT GATAATGTTGTCGTCATGGAAGCAGACGTTGGATTAAATTTACAGAAAGAGGCTTGA
AA sequence Show only first row Show all	>Lus10005525 pacid=23158843 polypeptide=Lus10005525 locus=Lus10005525.g ID=Lus10005525.BGIv1.0 annot-version=v1.0 MDSAKVGSFSATRSVTASVMLVAVLLMASCYRETAAARPLLEINIQSLQRGPVPSSKSSPCGHVPNRGTGKCTLAGMNVAGEGLRVRSPPAPVVAHPVAD DNVVVMEADVGLNLQKEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005525 [exp]	0	1
					Lus10006567 [exp]	1.0	0.9943
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10015208 [exp]	1.4	0.9812
AT1G74360			Leucine-rich repeat protein ki...		Lus10015729 [exp]	4.7	0.9685
AT2G39380		ATEXO70H2	exocyst subunit exo70 family p...		Lus10015221 [exp]	6.3	0.9722
AT2G37430	C2H2ZnF	ZAT11	C2H2 and C2HC zinc fingers sup...		Lus10024428 [exp]	8.1	0.9721
AT3G48180			unknown protein		Lus10043469 [exp]	9.2	0.9795
AT1G65690			Late embryogenesis abundant (L...		Lus10007364 [exp]	10.1	0.9659
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10027586 [exp]	11.6	0.9726
AT3G05170			Phosphoglycerate mutase family...		Lus10031518 [exp]	13.1	0.9624
AT1G58420			Uncharacterised conserved prot...		Lus10012496 [exp]	13.9	0.9612

Compare expression of checked genes

Lus10005525 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.