Lus10005537 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53950 311 / 4e-105 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT3G15170 278 / 7e-93 NAC ATNAC1, CUC1, ANAC054 CUP-SHAPED COTYLEDON1, Arabidopsis NAC domain containing protein 54, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT5G61430 273 / 9e-91 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1)
AT5G07680 267 / 2e-88 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2)
AT5G18270 261 / 7e-86 NAC ANAC087 Arabidopsis NAC domain containing protein 87 (.1.2)
AT2G24430 254 / 2e-83 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
AT5G39610 253 / 3e-83 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1)
AT3G18400 253 / 4e-83 NAC ANAC058 NAC domain containing protein 58 (.1)
AT3G29035 249 / 2e-81 NAC ORS1, AtNAC3, ANAC059 ORE1 SISTER1, Arabidopsis NAC domain containing protein 59, NAC domain containing protein 3 (.1)
AT3G04060 247 / 2e-80 NAC ANAC046 NAC domain containing protein 46 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041924 389 / 5e-138 AT5G53950 281 / 9e-95 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10021659 268 / 2e-88 AT5G61430 361 / 8e-125 NAC domain containing protein 100 (.1)
Lus10001648 268 / 2e-88 AT5G61430 359 / 4e-124 NAC domain containing protein 100 (.1)
Lus10026879 254 / 5e-83 AT5G18270 325 / 3e-110 Arabidopsis NAC domain containing protein 87 (.1.2)
Lus10009669 251 / 8e-82 AT3G18400 308 / 3e-104 NAC domain containing protein 58 (.1)
Lus10009029 249 / 4e-81 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1)
Lus10003435 249 / 1e-80 AT5G18270 315 / 2e-106 Arabidopsis NAC domain containing protein 87 (.1.2)
Lus10020165 249 / 2e-80 AT2G24430 306 / 2e-102 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
Lus10026966 247 / 1e-79 AT2G24430 311 / 6e-105 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G396300 327 / 6e-112 AT5G53950 299 / 5e-100 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.011G115400 309 / 2e-104 AT5G53950 312 / 1e-104 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.012G001400 275 / 8e-91 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1)
Potri.015G020000 266 / 1e-87 AT5G61430 446 / 1e-157 NAC domain containing protein 100 (.1)
Potri.019G031600 265 / 2e-86 AT5G18270 328 / 6e-111 Arabidopsis NAC domain containing protein 87 (.1.2)
Potri.013G054200 262 / 1e-85 AT5G18270 339 / 4e-115 Arabidopsis NAC domain containing protein 87 (.1.2)
Potri.005G255900 259 / 2e-84 AT1G76420 295 / 4e-98 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.002G005800 259 / 2e-84 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.006G277000 256 / 6e-84 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
Potri.012G056300 253 / 6e-83 AT3G18400 317 / 6e-108 NAC domain containing protein 58 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02365 NAM No apical meristem (NAM) protein
Representative CDS sequence
>Lus10005537 pacid=23139624 polypeptide=Lus10005537 locus=Lus10005537.g ID=Lus10005537.BGIv1.0 annot-version=v1.0
ATGGATCCACACCCTTTCCTCCCTTGCTTCCCATACTCCAACCCTCCTCCATCAACCGACTACACCACCACCGCCAATTTCAACTACACTTCCTCCGCCA
ACCACCACCAACAAAACCAAACCACCAACCTCCCACCAGGCTTCAGATTCCACCCGACCGACGAGGAGCTCATAACATACTACCTCCTCAAAAAGGTCAT
GGACTCCTCCTTCTCCGGCCGCGCCATAGCCGAGGTGGACCTCAACAAGTGCGAGCCTTGGCACTTGCCGGAGAAGGCCAAGATGGGGGAGAAAGAGTGG
TACTTCTTCTCCCTCCGAGACCGCAAGTATCCGACCGGTCTCCGGACCAATCGGGCCACCGAGGCCGGGTACTGGAAGGCTACTGGAAAGGACAGGGAGA
TCTACAGTAGCAAAAGCTGTGCCCTTGTTGGGATGAAGAAGACTCTTGTTTTCTACCGTGGGAGGGCTCCTAAGGGTGAGAAGAGCAATTGGGTCATGCA
TGAGTATCGTTTGGAAGGGAAGTTCTCGTATCACTATCTCTCTCGCTCGTCCAAGGATGAGTGGGTGATCTCCCGAGTTTTCCAGAAGACCGGCGCCGGC
GCCGGAAGCTGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGGCCGCTAAAAGCGGAAGCACGACGACCTCGTCCAAGAAGCCACGCTACAACA
ACTCGGCGGCGGCGGGGCTTTACCAGGAAGTGAACTCTCCTACGTCCTCGGTGTCGCATCTCCCGCCTCTGCTGGACCCCACCACCGGTGACAGCTGCTC
CTACGACGGCGGCAACCATTCCGTCCGTCACCAGCAGCAGCACGTGTCCTGTTTCTCCACTAGCTCCACCGTTGATGCTACTCAGAACCATCACTTGATG
CTCATCAAAGCCATCACCACCAGATGCTGA
AA sequence
>Lus10005537 pacid=23139624 polypeptide=Lus10005537 locus=Lus10005537.g ID=Lus10005537.BGIv1.0 annot-version=v1.0
MDPHPFLPCFPYSNPPPSTDYTTTANFNYTSSANHHQQNQTTNLPPGFRFHPTDEELITYYLLKKVMDSSFSGRAIAEVDLNKCEPWHLPEKAKMGEKEW
YFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSKSCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLEGKFSYHYLSRSSKDEWVISRVFQKTGAG
AGSCXXXXXXXXXXXTAAKSGSTTTSSKKPRYNNSAAAGLYQEVNSPTSSVSHLPPLLDPTTGDSCSYDGGNHSVRHQQQHVSCFSTSSTVDATQNHHLM
LIKAITTRC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10005537 0 1
AT1G65870 Disease resistance-responsive ... Lus10016231 1.0 0.9973
Lus10026293 1.4 0.9973
AT2G35160 SGD9, SUVH5 SET DOMAIN-CONTAINING PROTEIN ... Lus10043211 2.0 0.9959
AT5G45980 HD WOX9B, STPL, WO... WUSCHEL related homeobox 9B, S... Lus10013960 3.5 0.9967
AT2G28790 Pathogenesis-related thaumatin... Lus10005453 3.5 0.9895
AT2G17950 HD WUS1, PGA6, WUS WUSCHEL 1, WUSCHEL, Homeodomai... Lus10041909 4.5 0.9956
AT5G45980 HD WOX9B, STPL, WO... WUSCHEL related homeobox 9B, S... Lus10005282 4.5 0.9911
AT3G05600 alpha/beta-Hydrolases superfam... Lus10029878 4.6 0.9951
Lus10016534 4.7 0.9902
AT2G13820 AtXYP2 xylogen protein 2, Bifunctiona... Lus10031115 5.8 0.9781

Lus10005537 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.