Lus10005538 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15190 130 / 2e-38 chloroplast 30S ribosomal protein S20, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041925 229 / 9e-77 AT3G15190 160 / 1e-49 chloroplast 30S ribosomal protein S20, putative (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G396600 153 / 3e-47 AT3G15190 144 / 9e-44 chloroplast 30S ribosomal protein S20, putative (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01649 Ribosomal_S20p Ribosomal protein S20
Representative CDS sequence
>Lus10005538 pacid=23139638 polypeptide=Lus10005538 locus=Lus10005538.g ID=Lus10005538.BGIv1.0 annot-version=v1.0
ATGGCAGCTGCAGTGTTATCTTGCTGCTCTTCCCTTACTTCCAGACTCAACAACCTCTCAATCACCGCCATTCCATCCTCTTCTTCTCCTCAATCTCACT
CCAACCCTTTCCGCTCCATCAAATTCTCTTCTTCCCTTCCCCCCAACAACAATGGCGAGTCTAGGTGTCTGTCGATGACCCAGCGTTCTCTGCGGCGGTC
TACGGTGGTCTGCGAGGCTACTCCCGCTGGCAAAAAGGCTGACTCAGCTGCCAAGCGAGCCCGTCAGAACGAGAAACGAAGGATTTATCATAAGGCGCAC
AAGTCCGAAGTTAGAACCCGGATGAGGAAGGTATTGGAAGCGCTACTCAAGTTGAGAAAGAAGAAAGAGGCAGAACCTGAGGAGGTCCTTCCAATTGAGA
CACTAATTGCCGAAGCCTATTCAGTCATCGATAAAGCTGTAAAGGTGGGATCGCTGCATCGGAATACTGGAGCAAGGAGAAAGTCGCGGCTTGCTAGGGG
TAAGAGGGCTGTTGCTATTCGCCATGGATGGTACACCCCTTCTTCCTCCACTGACGAATCTGCATCAGTTTCTACATAA
AA sequence
>Lus10005538 pacid=23139638 polypeptide=Lus10005538 locus=Lus10005538.g ID=Lus10005538.BGIv1.0 annot-version=v1.0
MAAAVLSCCSSLTSRLNNLSITAIPSSSSPQSHSNPFRSIKFSSSLPPNNNGESRCLSMTQRSLRRSTVVCEATPAGKKADSAAKRARQNEKRRIYHKAH
KSEVRTRMRKVLEALLKLRKKKEAEPEEVLPIETLIAEAYSVIDKAVKVGSLHRNTGARRKSRLARGKRAVAIRHGWYTPSSSTDESASVST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15190 chloroplast 30S ribosomal prot... Lus10005538 0 1
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Lus10027894 1.4 0.9768
AT3G56910 PSRP5 plastid-specific 50S ribosomal... Lus10037307 2.0 0.9711
AT1G29070 Ribosomal protein L34 (.1) Lus10013928 5.2 0.9666
AT3G15190 chloroplast 30S ribosomal prot... Lus10041925 6.9 0.9526
AT1G29910 AB180, LHCB1.2,... LIGHT HARVESTING CHLOROPHYLL A... Lus10027966 7.6 0.9165
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10038770 8.0 0.9657
AT3G56910 PSRP5 plastid-specific 50S ribosomal... Lus10035720 9.2 0.9542
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10039092 9.2 0.9625
AT5G65220 Ribosomal L29 family protein ... Lus10019653 10.4 0.9556
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10000520 10.4 0.9451

Lus10005538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.