Lus10005539 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02270 103 / 2e-27 RHS13 root hair specific 13 (.1)
AT2G47540 102 / 8e-27 Pollen Ole e 1 allergen and extensin family protein (.1)
AT3G62680 83 / 2e-18 ATPRP3, PRP3 ARABIDOPSIS THALIANA PROLINE-RICH PROTEIN 3, proline-rich protein 3 (.1)
AT1G54970 81 / 2e-17 RHS7, ATPRP1 ROOT HAIR SPECIFIC 7, proline-rich protein 1 (.1)
AT2G47530 78 / 2e-17 Pollen Ole e 1 allergen and extensin family protein (.1)
AT2G33790 49 / 6e-07 ATAGP30 arabinogalactan protein 30 (.1)
AT3G09925 48 / 1e-06 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041926 446 / 5e-161 AT4G02270 100 / 5e-26 root hair specific 13 (.1)
Lus10013419 135 / 9e-39 AT4G02270 118 / 3e-33 root hair specific 13 (.1)
Lus10008213 135 / 4e-38 AT2G47540 127 / 2e-36 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10015434 57 / 2e-09 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2)
Lus10010306 53 / 1e-08 ND 38 / 9e-04
Lus10014013 53 / 4e-08 AT2G34700 137 / 2e-40 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10040948 44 / 3e-05 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10009837 44 / 4e-05 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G126300 124 / 3e-33 AT2G47540 114 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.014G126200 122 / 8e-33 AT2G47540 114 / 3e-30 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.014G126250 122 / 1e-32 AT2G47540 112 / 2e-29 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.014G126500 120 / 5e-32 AT2G47540 113 / 6e-30 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.017G145800 115 / 5e-31 AT4G02270 118 / 5e-33 root hair specific 13 (.1)
Potri.002G201800 106 / 4e-28 AT4G02270 118 / 1e-33 root hair specific 13 (.1)
Potri.002G201900 100 / 3e-26 AT2G47540 160 / 1e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.011G053600 50 / 5e-07 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.010G185400 45 / 1e-05 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0287 Transthyretin PF01190 Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence
>Lus10005539 pacid=23139666 polypeptide=Lus10005539 locus=Lus10005539.g ID=Lus10005539.BGIv1.0 annot-version=v1.0
ATGGCCGCAACCCATTTCTTGACCGTGTCATTCCTCCTCGTCTTGTCCATGTCACTAGCCATTGCATCCACGACCGATTACATAACTGCTGTCAAACCTC
AAACTAGCTACACTCCGAAACCAAGCTTCGACTTGAAACCAAAACCAGATGGTGACTTGTATGCCAAACCAGTTGATGTCACACATAAACCAGCTTATGG
CGGGTATATCTCCACGCCGGGGTTGGAGAAGCTGAAGCTGAGGATGCTTCAATACCAAGGGGCTAACCGAGCCAATCAAGTTGTCCCCAAACATAAACAT
GGAAATGCATATCGCCCAAAACCAGAGGCGGTTCAGCATCCCGAGTCTCAAACTAGCAGCATCAAACCGGCACCATACGTGGTCCAGAAGGCAGAAGATG
GGTTTGGGGTTGGCGTTGAAGGCATAGTTGCGTGCAAATCGGGATCCGACTACTTCCCACTTCAAGGAGCTGTGGTGAGAATAAGTTGTACGGGAGCCGA
GAAGGAGGAGAAGCAAGTATGGAGCTTGACAGATGAAAGGGGTTATTTCTTCAAGCTATTGCATGAGCATAAGGAATCAGACTACTGCAAGGCTTTCCTA
GAGCATTCGCCACTAAAGAAATGCAGTTTCAGCACAGATGTGAACAAGGGGACGAGTGGCGCCAAACTCTCCACCTACAAAATTCTACATGATAAAAGCA
TCAAGCTTTACCCGGTTGGACCTTTCTTCTACTCTCCCGGCGGCTACTGA
AA sequence
>Lus10005539 pacid=23139666 polypeptide=Lus10005539 locus=Lus10005539.g ID=Lus10005539.BGIv1.0 annot-version=v1.0
MAATHFLTVSFLLVLSMSLAIASTTDYITAVKPQTSYTPKPSFDLKPKPDGDLYAKPVDVTHKPAYGGYISTPGLEKLKLRMLQYQGANRANQVVPKHKH
GNAYRPKPEAVQHPESQTSSIKPAPYVVQKAEDGFGVGVEGIVACKSGSDYFPLQGAVVRISCTGAEKEEKQVWSLTDERGYFFKLLHEHKESDYCKAFL
EHSPLKKCSFSTDVNKGTSGAKLSTYKILHDKSIKLYPVGPFFYSPGGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02270 RHS13 root hair specific 13 (.1) Lus10005539 0 1
AT5G22410 RHS18 root hair specific 18 (.1) Lus10004859 1.7 0.9440
AT1G30870 Peroxidase superfamily protein... Lus10038393 3.5 0.8970
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10025762 4.7 0.8341
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10040948 6.9 0.8733
AT3G10710 RHS12 root hair specific 12 (.1) Lus10033399 7.7 0.8732
AT1G63450 RHS8 root hair specific 8 (.1) Lus10000604 8.1 0.8613
AT1G30870 Peroxidase superfamily protein... Lus10001228 8.8 0.8596
AT1G48930 ATGH9C1 glycosyl hydrolase 9C1 (.1) Lus10017402 9.9 0.8554
AT1G12560 ATHEXPALPHA1.26... expansin A7 (.1) Lus10006711 11.0 0.8442
AT4G02270 RHS13 root hair specific 13 (.1) Lus10041926 11.3 0.8523

Lus10005539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.