Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28270 67 / 2e-15 RALFL4 ralf-like 4 (.1) AT2G33775 66 / 3e-15 RALFL19 ralf-like 19 (.1) AT3G05490 64 / 2e-14 RALFL22 ralf-like 22 (.1) AT4G15800 57 / 6e-12 RALFL33 ralf-like 33 (.1) AT3G16570 58 / 8e-12 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT1G02900 57 / 8e-12 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT4G13950 51 / 2e-09 RALFL31 ralf-like 31 (.1) AT3G23805 50 / 3e-09 RALFL24 ralf-like 24 (.1) AT5G67070 42 / 5e-06 RALFL34 ralf-like 34 (.1) AT2G20660 42 / 6e-06 RALFL14 ralf-like 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015316 [exp] 92 / 2e-25 AT1G28270 100 / 7e-29 ralf-like 4 (.1) Lus10025444 [exp] 92 / 2e-25 AT1G28270 100 / 2e-28 ralf-like 4 (.1) Lus10015431 [exp] 88 / 1e-23 AT1G28270 81 / 7e-21 ralf-like 4 (.1) Lus10029893 [exp] 68 / 5e-16 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10020647 [exp] 67 / 3e-15 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10000502 [exp] 64 / 4e-14 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10037512 [exp] 64 / 4e-14 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10015172 [exp] 59 / 1e-12 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10022561 [exp] 50 / 6e-09 AT4G13950 100 / 1e-28 ralf-like 31 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G045000 [exp] 77 / 1e-19 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G044900 [exp] 77 / 1e-19 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.014G131800 [exp] 61 / 2e-13 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.013G017400 [exp] 61 / 4e-13 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.005G025800 [exp] 59 / 2e-12 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.008G208200 [exp] 59 / 2e-12 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.001G320700 [exp] 52 / 9e-10 AT3G23805 96 / 1e-26 ralf-like 24 (.1) Potri.017G059500 [exp] 51 / 4e-09 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.007G044700 [exp] 47 / 1e-07 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.014G026900 [exp] 45 / 6e-07 AT5G67070 94 / 6e-26 ralf-like 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10005541 pacid=23139653 polypeptide=Lus10005541 locus=Lus10005541.g ID=Lus10005541.BGIv1.0 annot-version=v1.0 ATGGCCACCACGACACGCACTCCCACGTCGTTGTTGTTGGTCCTAGTAGCGTTGTTGTTGATCGCGACATCGGCCGAGGCGACGAGGGAGAGCCAGACGG CGAGATTACTGCTAATGCAGAGATTTAACAAGAGAACGTCAAGAGGGCTTCAACAGAGAGACCGTTACATAAGCTACGAAGCGATGTCCGCAAACAACGT GCCTTGTGGGAAACACGGGAACTCGTACTACAACTGTAACACCCACACCAGGGCTAACCCTTACACTCGCGGCTGCACTGAAGCCACCGGATGCTATAGA TACACCCATTGA
AA sequence Show only first row Show all	>Lus10005541 pacid=23139653 polypeptide=Lus10005541 locus=Lus10005541.g ID=Lus10005541.BGIv1.0 annot-version=v1.0 MATTTRTPTSLLLVLVALLLIATSAEATRESQTARLLLMQRFNKRTSRGLQQRDRYISYEAMSANNVPCGKHGNSYYNCNTHTRANPYTRGCTEATGCYR YTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28270		RALFL4	ralf-like 4 (.1)		Lus10005541 [exp]	0	1
					Lus10027052 [exp]	3.6	0.6834
AT2G07180			Protein kinase superfamily pro...		Lus10008546 [exp]	8.8	0.5804
					Lus10012623 [exp]	12.6	0.6214
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015753 [exp]	14.8	0.6481
AT2G39730		RCA	rubisco activase (.1.2.3)		Lus10003234 [exp]	14.8	0.6555
					Lus10032803 [exp]	18.2	0.5886
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	26.1	0.5732
					Lus10033149 [exp]	27.7	0.5732
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10023215 [exp]	29.2	0.5732
AT3G14040			Pectin lyase-like superfamily ...		Lus10023364 [exp]	30.6	0.5732

Compare expression of checked genes

Lus10005541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.