Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53130 125 / 5e-38 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1) AT5G55110 79 / 5e-20 Stigma-specific Stig1 family protein (.1) AT4G26880 73 / 1e-17 Stigma-specific Stig1 family protein (.1) AT1G50720 71 / 9e-17 Stigma-specific Stig1 family protein (.1) AT1G50650 69 / 6e-16 Stigma-specific Stig1 family protein (.1) AT1G11925 60 / 8e-13 Stigma-specific Stig1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041930 [exp] 206 / 3e-70 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10011146 [exp] 74 / 7e-18 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Lus10043047 [exp] 74 / 9e-18 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1) Lus10011117 [exp] 70 / 4e-16 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1) Lus10006512 [exp] 65 / 1e-14 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1) Lus10000696 [exp] 63 / 3e-13 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1) Lus10020831 [exp] 52 / 2e-09 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1) Lus10012679 [exp] 52 / 3e-09 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G399200 [exp] 120 / 3e-36 AT1G53130 149 / 2e-46 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Potri.011G118600 [exp] 117 / 3e-35 AT1G53130 136 / 1e-41 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Potri.004G006900 [exp] 72 / 2e-17 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1) Potri.001G355700 [exp] 72 / 4e-17 AT1G50650 119 / 9e-35 Stigma-specific Stig1 family protein (.1) Potri.011G008932 [exp] 66 / 6e-15 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1) Potri.011G008804 [exp] 66 / 7e-15 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1) Potri.011G009000 [exp] 66 / 8e-15 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.004G007100 [exp] 65 / 2e-14 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.004G030900 [exp] 64 / 4e-14 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1) Potri.011G009100 [exp] 64 / 4e-14 AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04885 [flax] [poplar] Stig1 Stigma-specific protein, Stig1
Representative CDS sequence Show only first row Show all	>Lus10005544 pacid=23139664 polypeptide=Lus10005544 locus=Lus10005544.g ID=Lus10005544.BGIv1.0 annot-version=v1.0 ATGAGCCTGTTCCTCAAGGACAAGATAAGGAAAGGCATGAAGTGCTACCCCGGAGGAAGCAACATCTGCGACGGAGTTTCGGCCAACAACGGGACAGCTA TGCTCTACTGCTGCAAGAACAACTGCAGGAATGTGGTCCAGGACGTCAACAACTGCGGGTCCTGCGGGACCAGGTGCGGGTTCGGGCTACGATGCTGCAA TGGTGCCTGCATCAGCGTGGCTTATGATCCTAACCACTGTGGGGAGTGTAACCAGAAGTGCTCGCCCGGGCAGAAGTGCGAGTATGGTTCCTGTGGCTAT GCTTGA
AA sequence Show only first row Show all	>Lus10005544 pacid=23139664 polypeptide=Lus10005544 locus=Lus10005544.g ID=Lus10005544.BGIv1.0 annot-version=v1.0 MSLFLKDKIRKGMKCYPGGSNICDGVSANNGTAMLYCCKNNCRNVVQDVNNCGSCGTRCGFGLRCCNGACISVAYDPNHCGECNQKCSPGQKCEYGSCGY A

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53130		GRI	GRIM REAPER, Stigma-specific S...		Lus10005544 [exp]	0	1
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Lus10001637 [exp]	1.7	0.9875
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10010940 [exp]	2.4	0.9732
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Lus10001429 [exp]	2.4	0.9824
AT1G68150	WRKY	ATWRKY9, WRKY9	WRKY DNA-binding protein 9 (.1...		Lus10035971 [exp]	3.0	0.9788
					Lus10025963 [exp]	3.5	0.9682
AT4G10350	NAC	BRN2, NST4, ANA...	BEARSKIN 2, NAC domain contain...		Lus10039153 [exp]	4.2	0.9709
AT3G18200			nodulin MtN21 /EamA-like trans...		Lus10038959 [exp]	6.3	0.9732
AT1G06930			unknown protein		Lus10009929 [exp]	6.6	0.9768
AT4G12470		AZI1	azelaic acid induced 1 (.1)		Lus10032261 [exp]	7.5	0.9570
AT2G45570		CYP76C2	"cytochrome P450, family 76, s...		Lus10027426 [exp]	7.9	0.9718

Compare expression of checked genes

Lus10005544 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.