Lus10005553 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78630 329 / 7e-115 EMB1473 embryo defective 1473, Ribosomal protein L13 family protein (.1)
AT3G01790 79 / 9e-18 Ribosomal protein L13 family protein (.1.2)
AT5G48760 45 / 1e-05 Ribosomal protein L13 family protein (.1.2)
AT3G24830 45 / 1e-05 Ribosomal protein L13 family protein (.1)
AT3G07110 44 / 3e-05 Ribosomal protein L13 family protein (.1.2)
AT4G13170 43 / 7e-05 Ribosomal protein L13 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041940 383 / 1e-135 AT1G78630 317 / 4e-110 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Lus10014597 79 / 2e-17 AT3G01790 309 / 3e-108 Ribosomal protein L13 family protein (.1.2)
Lus10032063 78 / 8e-17 AT3G01790 308 / 3e-107 Ribosomal protein L13 family protein (.1.2)
Lus10016679 47 / 2e-06 AT5G48760 386 / 9e-139 Ribosomal protein L13 family protein (.1.2)
Lus10032599 47 / 3e-06 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10043151 47 / 3e-06 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10007137 47 / 4e-06 AT5G48760 384 / 6e-138 Ribosomal protein L13 family protein (.1.2)
Lus10011857 46 / 6e-06 AT5G48760 394 / 8e-142 Ribosomal protein L13 family protein (.1.2)
Lus10022793 46 / 6e-06 AT5G48760 390 / 2e-140 Ribosomal protein L13 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G384600 334 / 1e-116 AT1G78630 351 / 1e-123 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.011G106100 333 / 2e-116 AT1G78630 342 / 3e-120 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.001G334000 83 / 3e-19 AT3G01790 299 / 2e-104 Ribosomal protein L13 family protein (.1.2)
Potri.017G066000 83 / 4e-19 AT3G01790 266 / 3e-91 Ribosomal protein L13 family protein (.1.2)
Potri.017G054600 48 / 2e-06 AT5G48760 351 / 5e-125 Ribosomal protein L13 family protein (.1.2)
Potri.001G314500 47 / 3e-06 AT5G48760 384 / 7e-138 Ribosomal protein L13 family protein (.1.2)
Potri.002G242600 46 / 5e-06 AT4G13170 357 / 4e-127 Ribosomal protein L13 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00572 Ribosomal_L13 Ribosomal protein L13
Representative CDS sequence
>Lus10005553 pacid=23139636 polypeptide=Lus10005553 locus=Lus10005553.g ID=Lus10005553.BGIv1.0 annot-version=v1.0
ATGGCGCTGCTTCACGGCTCATCCTCCATTGTTTTACCACCATCTTCTTCTACTTTCCTCTCTTCATCTTCGTCGTCAAATCCCAGCAGCATTGTTAGTA
CCAGCAGTCCTTTCGTGGTCGGATTCTCTGGCGCAAGGTTGCAGCTTTCTGCGCGGAAGTCTTGGGCTATTGGTTCCCAGAAGACAGCTTTCAAGCTCCC
TCCTCCATTTCCCCCCAAGAAGAAGGAGAAGAAGGAGAAAAAGGAAAAGCCCCCTCACATCCCTGTTGACCAACGCTGGATGGTTGAAGAATCTGAAGTC
GGCGGTCCTGATATTTGGAACACGACGTGGTATCCTAAAGCTGCTGATCATGTGAACACTGAAAAGCCATGGTTCATTGTAGATGCAACTGACAAGATTT
TGGGGAGATTGGCATCGACCATTGCTATTCATATCCGTGGGAAGAATTTGGGAACATTCACTCCCAGTGTGGACATGGGTGCTTTTGTGATTGTGGTGAA
CGCAGAGAAAGTCGCTGTATCTGGGAAGAAGAGAACCCAAAAGTTATACAGGAGGCATTCTGGAAGACCAGGTGGGATGACAGTAGAGACCTTTGATCAG
TTGCAGCAAAGGATCCCAGAAAGGATTATCGAACATGCGGTCCGTGGAATGCTTCCTAAAGGGAGGCTTGGGAGAGCACTGTTCAACCACCTGAAAGTTT
ACAAGGGACCAGACCATCCTCATGAGGCTCAAATGCCCAAGGAGTTGCCGATAAGGGACAAAAGAATACAAAAGCAGACTTAG
AA sequence
>Lus10005553 pacid=23139636 polypeptide=Lus10005553 locus=Lus10005553.g ID=Lus10005553.BGIv1.0 annot-version=v1.0
MALLHGSSSIVLPPSSSTFLSSSSSSNPSSIVSTSSPFVVGFSGARLQLSARKSWAIGSQKTAFKLPPPFPPKKKEKKEKKEKPPHIPVDQRWMVEESEV
GGPDIWNTTWYPKAADHVNTEKPWFIVDATDKILGRLASTIAIHIRGKNLGTFTPSVDMGAFVIVVNAEKVAVSGKKRTQKLYRRHSGRPGGMTVETFDQ
LQQRIPERIIEHAVRGMLPKGRLGRALFNHLKVYKGPDHPHEAQMPKELPIRDKRIQKQT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Lus10005553 0 1
AT3G13120 Ribosomal protein S10p/S20e fa... Lus10016604 1.0 0.9891
AT5G66470 RNA binding;GTP binding (.1) Lus10014289 1.4 0.9873
AT5G54600 Translation protein SH3-like f... Lus10038125 1.7 0.9848
AT1G09900 Pentatricopeptide repeat (PPR-... Lus10015110 2.2 0.9742
AT5G55220 trigger factor type chaperone ... Lus10010250 2.8 0.9698
AT3G13120 Ribosomal protein S10p/S20e fa... Lus10007111 3.0 0.9698
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10026571 3.6 0.9665
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10038770 4.0 0.9774
AT1G62780 unknown protein Lus10032229 4.7 0.9566
AT4G32320 APX6 ascorbate peroxidase 6 (.1) Lus10002916 4.9 0.9719

Lus10005553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.