Lus10005571 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G53530 214 / 5e-72 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
AT1G23465 152 / 8e-48 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G29960 147 / 2e-45 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT3G08980 84 / 7e-21 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT2G30440 60 / 4e-11 Plsp2B, TPP plastidic type I signal peptidase 2B, thylakoid processing peptide (.1)
AT1G06870 59 / 1e-10 Plsp2A plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
AT3G24590 58 / 2e-10 PLSP1 plastidic type i signal peptidase 1 (.1)
AT2G31140 50 / 1e-07 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G06200 49 / 3e-07 Peptidase S24/S26A/S26B/S26C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013703 325 / 6e-109 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Lus10025393 176 / 1e-56 AT1G53530 169 / 3e-54 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10033448 147 / 3e-46 AT1G53530 110 / 1e-32 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10015755 119 / 1e-34 AT1G53530 86 / 4e-22 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10015272 114 / 4e-32 AT1G53530 111 / 4e-31 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10036985 95 / 6e-23 AT2G44220 218 / 7e-65 Protein of Unknown Function (DUF239) (.1)
Lus10002492 85 / 3e-21 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10004822 83 / 3e-20 AT3G08980 190 / 9e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10022921 64 / 7e-13 AT2G31140 282 / 1e-97 Peptidase S24/S26A/S26B/S26C family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G380400 214 / 3e-72 AT1G53530 227 / 3e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.007G071400 184 / 4e-60 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.005G092900 170 / 2e-54 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.016G115100 90 / 6e-23 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.014G036400 61 / 3e-11 AT1G06870 377 / 8e-130 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.006G157900 54 / 5e-09 AT3G24590 357 / 5e-124 plastidic type i signal peptidase 1 (.1)
Potri.002G079600 53 / 5e-09 AT3G24590 177 / 3e-55 plastidic type i signal peptidase 1 (.1)
Potri.018G081800 52 / 3e-08 AT3G24590 372 / 3e-130 plastidic type i signal peptidase 1 (.1)
Potri.005G225100 49 / 2e-07 AT2G31140 274 / 2e-94 Peptidase S24/S26A/S26B/S26C family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0299 Peptidase_SF PF10502 Peptidase_S26 Signal peptidase, peptidase S26
CL0299 Peptidase_SF PF00717 Peptidase_S24 Peptidase S24-like
Representative CDS sequence
>Lus10005571 pacid=23139641 polypeptide=Lus10005571 locus=Lus10005571.g ID=Lus10005571.BGIv1.0 annot-version=v1.0
ATGAGCTACTTCAACCAATGGTCATCCTTTGCACAAGACACCACAGCCAAAGCTTCAATCGCCGCCAAGTTCCTCTCTTTCCTTCACATTACTGATTCCT
ACATAGTCTCCACCACTCTCGTTCAGGGGCCTAGCATGCTCCCCACATTGAATTACTCAGGCGATGTGCTTCTGATTGAACACTTGTCTCACCGGTTGGG
GAAGCTTGAACCTGGAGACATTGTTCTTGTTCGATCCCCGGTCGAACCCAGAAAGATTGTGGCTAAACGAATAGTTGGGATGGAAGGTGATCGCGTCACT
TTCCTCACTGACCCTTCCCGCAGTGAGAATTCCCTCACTGTCTTGGTTCCAAAAGGGCATGTTTGGATTCAGGGGGACAATGTGTATGCTTCTGCTGATT
CGAGATATTTCGGTCCTGTTCCGTATGGTTTGATTCAAGGAAGAGCTTTTTTAAGGGTGACCATATCTTTCTTTCCTCTTTGCAGAGTATCTTTACGTGA
TTTCTTATTCTAA
AA sequence
>Lus10005571 pacid=23139641 polypeptide=Lus10005571 locus=Lus10005571.g ID=Lus10005571.BGIv1.0 annot-version=v1.0
MSYFNQWSSFAQDTTAKASIAAKFLSFLHITDSYIVSTTLVQGPSMLPTLNYSGDVLLIEHLSHRLGKLEPGDIVLVRSPVEPRKIVAKRIVGMEGDRVT
FLTDPSRSENSLTVLVPKGHVWIQGDNVYASADSRYFGPVPYGLIQGRAFLRVTISFFPLCRVSLRDFLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53530 Peptidase S24/S26A/S26B/S26C f... Lus10005571 0 1
AT1G03430 AHP5 histidine-containing phosphotr... Lus10027965 20.0 0.7892
AT1G54920 unknown protein Lus10004472 50.3 0.8039
AT4G16280 FCA RNA binding;abscisic acid bind... Lus10029574 51.8 0.7876
AT4G25320 AT-hook AT hook motif DNA-binding fami... Lus10038903 53.9 0.7963
AT1G02840 ATSRP34, SR1, S... Serine/Arginine-Rich Protein S... Lus10007869 54.3 0.7764
AT1G09020 ATSNF4, SNF4 homolog of yeast sucrose nonfe... Lus10031501 103.4 0.7577
AT4G23660 ATPPT1 polyprenyltransferase 1 (.1.2.... Lus10033224 107.1 0.7830
AT3G12170 Chaperone DnaJ-domain superfam... Lus10013402 115.7 0.7687
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10040933 141.4 0.7430
AT1G63500 Protein kinase protein with te... Lus10001998 144.3 0.7654

Lus10005571 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.