Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20710 89 / 6e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G60770 85 / 2e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G02150 78 / 5e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G01990 74 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21705 72 / 4e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02820 69 / 9e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G02370 68 / 1e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G28020 67 / 4e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G15480 67 / 4e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G27460 59 / 4e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016229 [exp] 189 / 3e-60 AT2G20710 269 / 7e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10029335 [exp] 126 / 7e-39 AT2G20710 76 / 2e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10029313 [exp] 130 / 9e-38 AT2G20710 127 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10018588 [exp] 82 / 2e-19 AT2G20710 303 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10033698 [exp] 82 / 3e-19 AT2G20710 349 / 4e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10013047 [exp] 81 / 4e-19 AT1G60770 682 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021053 [exp] 77 / 1e-17 AT1G02370 494 / 3e-171 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004173 [exp] 74 / 1e-16 AT1G02370 419 / 1e-143 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009787 [exp] 70 / 3e-15 AT1G02150 600 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G063400 [exp] 114 / 9e-31 AT2G20710 349 / 3e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G132700 [exp] 97 / 9e-25 AT2G20710 387 / 2e-130 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.016G063300 [exp] 92 / 5e-23 AT2G20710 345 / 1e-113 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G132500 [exp] 91 / 1e-22 AT2G20710 388 / 4e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.006G157400 [exp] 88 / 2e-21 AT1G60770 682 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G133000 [exp] 87 / 3e-21 AT2G20710 310 / 1e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.018G079600 [exp] 86 / 8e-21 AT1G60770 701 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.011G120900 [exp] 76 / 3e-17 AT4G21705 483 / 8e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G050300 [exp] 73 / 3e-16 AT1G02150 698 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G139400 [exp] 72 / 4e-16 AT1G02150 714 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10005599 pacid=23158756 polypeptide=Lus10005599 locus=Lus10005599.g ID=Lus10005599.BGIv1.0 annot-version=v1.0 ATGATAGACAAAAGGCACTTGGAACTAACTTCACGAGATGCTGCAATAAGGCTGGACTTGATAGTTAAGGTTCAAGGGCTAAAACCAGCAGCCAACTACT TCGAAACTCTCCCTCAGCAGCTTAAAGGGGTCAATGCTTACGGCTCACTTTTCAACTGCTACTGTCGCATCCAGTCCGTGGAGAAGGCAGAGGCGGTAAT GCAAGAGATGAGGGACTTAGGGATCGACAAGACGAGCCTCCATTACAATACTTTGCTCACTCTTTACCATCGAATTGGGACACAGATGTTTGGCGATCTT ATCAAGGAGACTGCAGCATTCCATACAATGTCATAA
AA sequence Show only first row Show all	>Lus10005599 pacid=23158756 polypeptide=Lus10005599 locus=Lus10005599.g ID=Lus10005599.BGIv1.0 annot-version=v1.0 MIDKRHLELTSRDAAIRLDLIVKVQGLKPAANYFETLPQQLKGVNAYGSLFNCYCRIQSVEKAEAVMQEMRDLGIDKTSLHYNTLLTLYHRIGTQMFGDL IKETAAFHTMS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10005599 [exp]	0	1
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	3.6	0.8996
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	5.1	0.8996
AT2G34740			Protein phosphatase 2C family ...		Lus10038455 [exp]	5.8	0.7692
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	6.2	0.8996
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	7.2	0.8996
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10019977 [exp]	7.3	0.5704
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	8.1	0.8996
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021456 [exp]	8.8	0.8947
AT1G55790			Domain of unknown function (DU...		Lus10032900 [exp]	9.5	0.8840
					Lus10014629 [exp]	10.6	0.8699

Compare expression of checked genes

Lus10005599 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.