Lus10005600 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20710 92 / 2e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G02150 85 / 5e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02820 80 / 3e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G60770 79 / 1e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G27460 76 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21705 68 / 4e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G02370 67 / 7e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G01990 62 / 7e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G28020 54 / 5e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G11380 51 / 3e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029313 258 / 2e-86 AT2G20710 127 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10000247 234 / 7e-80 AT2G20710 92 / 3e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10016229 147 / 2e-43 AT2G20710 269 / 7e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10003590 99 / 4e-25 AT4G21705 434 / 2e-148 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000091 95 / 9e-24 AT4G21705 426 / 8e-147 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005855 95 / 1e-23 AT4G21705 503 / 5e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001213 89 / 2e-21 AT4G21705 500 / 2e-174 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008724 85 / 9e-20 AT5G27460 492 / 6e-171 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018588 79 / 1e-17 AT2G20710 303 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G063300 131 / 1e-36 AT2G20710 345 / 1e-113 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.011G051700 114 / 4e-32 AT2G20710 151 / 1e-43 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G133000 110 / 2e-29 AT2G20710 310 / 1e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G132500 110 / 3e-29 AT2G20710 388 / 4e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.016G063400 108 / 2e-28 AT2G20710 349 / 3e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G132700 104 / 6e-27 AT2G20710 387 / 2e-130 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.014G050300 97 / 3e-24 AT1G02150 698 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G120900 95 / 1e-23 AT4G21705 483 / 8e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G042500 94 / 2e-23 AT4G21705 608 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G139400 90 / 8e-22 AT1G02150 714 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10005600 pacid=23158754 polypeptide=Lus10005600 locus=Lus10005600.g ID=Lus10005600.BGIv1.0 annot-version=v1.0
ATGGGGAAGAAAGATGAAGTCTTTGCAGTTTGGGAACATCTCAAGAAGAGCGGGAAGAAGGTCCTCAACAAAGGGTACAGGGACGTGATATCTTCCCTCG
CGAAGCTGGGCGATTTCGAGGCTGCTGAGAAGATACTCGACGAGTGGGAGTCTCGAAAGAGCCCTGGTTACGATGTCCGTGTCCCTAACGTCCTCGTCGG
CGCCTACATGAAAGTCGGCCGCTTGGAAGAGGCCGAGGCAGTCGTGGAGAGGACGAGATCGAAAGGCGTTGAGCCACATGCGAACTCGTGGCTTTCGTTG
GCGGGAGGGTATCTCGAGCATCGTAAGGACGTGGTGAAGGCCGTGGAGGCTATAAAGAGAGGCGTAACAGTGTCGGAGTCGGGTTGGAAACCAGATCCCA
GAGGGTTGGCTGAGTGTCTGCAGTAG
AA sequence
>Lus10005600 pacid=23158754 polypeptide=Lus10005600 locus=Lus10005600.g ID=Lus10005600.BGIv1.0 annot-version=v1.0
MGKKDEVFAVWEHLKKSGKKVLNKGYRDVISSLAKLGDFEAAEKILDEWESRKSPGYDVRVPNVLVGAYMKVGRLEEAEAVVERTRSKGVEPHANSWLSL
AGGYLEHRKDVVKAVEAIKRGVTVSESGWKPDPRGLAECLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10005600 0 1
Lus10030974 7.1 0.5980
AT4G21870 HSP20-like chaperones superfam... Lus10018346 11.5 0.6157
AT3G44160 Outer membrane OMP85 family pr... Lus10004104 11.5 0.6267
AT3G19620 Glycosyl hydrolase family prot... Lus10002127 25.5 0.5936
Lus10008791 32.6 0.5914
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 35.7 0.5914
Lus10002152 38.5 0.5522
Lus10021851 38.6 0.5914
Lus10010117 39.1 0.5522
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025408 39.8 0.5522

Lus10005600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.