Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42200 108 / 4e-31 RING/U-box superfamily protein (.1) AT2G42350 72 / 2e-16 RING/U-box superfamily protein (.1) AT4G10150 72 / 4e-16 RING/U-box superfamily protein (.1) AT5G17600 72 / 5e-16 RING/U-box superfamily protein (.1) AT1G72310 71 / 1e-15 ATL3 RING/U-box superfamily protein (.1) AT1G72220 71 / 2e-15 RING/U-box superfamily protein (.1) AT5G10380 71 / 2e-15 ATRING1, RING1 RING/U-box superfamily protein (.1) AT1G33480 70 / 2e-15 RING/U-box superfamily protein (.1) AT5G66070 69 / 2e-15 RING/U-box superfamily protein (.1.2) AT4G40070 70 / 3e-15 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017253 [exp] 234 / 2e-81 AT5G42200 126 / 4e-38 RING/U-box superfamily protein (.1) Lus10034551 [exp] 161 / 2e-52 AT5G42200 112 / 2e-32 RING/U-box superfamily protein (.1) Lus10021842 [exp] 157 / 9e-51 AT5G42200 103 / 3e-29 RING/U-box superfamily protein (.1) Lus10004460 [exp] 74 / 2e-16 AT3G05200 307 / 6e-102 RING/U-box superfamily protein (.1) Lus10000333 [exp] 74 / 2e-16 AT3G05200 309 / 2e-102 RING/U-box superfamily protein (.1) Lus10002194 [exp] 73 / 2e-16 AT2G42360 153 / 4e-46 RING/U-box superfamily protein (.1) Lus10005815 [exp] 72 / 3e-16 AT1G49230 170 / 3e-53 RING/U-box superfamily protein (.1) Lus10034953 [exp] 72 / 1e-15 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1) Lus10005814 [exp] 70 / 1e-15 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G244500 [exp] 143 / 1e-44 AT5G42200 149 / 3e-46 RING/U-box superfamily protein (.1) Potri.002G017400 [exp] 142 / 2e-44 AT5G42200 154 / 2e-48 RING/U-box superfamily protein (.1) Potri.018G085001 [exp] 73 / 5e-16 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1) Potri.007G111900 [exp] 72 / 5e-16 AT4G33565 163 / 1e-46 RING/U-box superfamily protein (.1) Potri.015G056800 [exp] 72 / 7e-16 AT5G05810 263 / 8e-85 RING/U-box superfamily protein (.1) Potri.002G101800 [exp] 72 / 9e-16 AT1G72220 195 / 3e-58 RING/U-box superfamily protein (.1) Potri.017G049300 [exp] 71 / 2e-15 AT4G33565 166 / 6e-48 RING/U-box superfamily protein (.1) Potri.019G057700 [exp] 69 / 2e-15 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1) Potri.002G006400 [exp] 68 / 5e-15 AT1G76410 177 / 1e-56 RING/U-box superfamily protein (.1) Potri.013G025800 [exp] 69 / 1e-14 AT3G05200 261 / 9e-84 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [flax] [poplar] RING PF00097 [flax] [poplar] zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Lus10005617 pacid=23157216 polypeptide=Lus10005617 locus=Lus10005617.g ID=Lus10005617.BGIv1.0 annot-version=v1.0 ATGAGCGCTATGTTCGTCGTCTACATTTTCCTCCTCTGGTTCGCTTCAAATCCCCCGATTACCCACCCCACCGGCGGAGACGTATTCAAGCCCGAGGCCA AGATTGGACTATCGTCCTCCGAGCTGGAGAAGCTCCCCAAAGTTTCCGGGAAGGAGCTTGTGATGGGGAGCGAGTGTGCCGTCTGCCTCGATGAGATTGA GGCGGACGATCCAGCGAGGATGATTCCAGTATGTAACCACGGATACCATCTTGAATGCGCCGATAAGTGGCTCTCGAAGCATCCATTTTGCCCCGTTTGC CGCAGAAAAATCGATCTCGCTCAGTTCCTCAACCCCGACCCAGACGACAGTCCTTGCTGA
AA sequence Show only first row Show all	>Lus10005617 pacid=23157216 polypeptide=Lus10005617 locus=Lus10005617.g ID=Lus10005617.BGIv1.0 annot-version=v1.0 MSAMFVVYIFLLWFASNPPITHPTGGDVFKPEAKIGLSSSELEKLPKVSGKELVMGSECAVCLDEIEADDPARMIPVCNHGYHLECADKWLSKHPFCPVC RRKIDLAQFLNPDPDDSPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42200			RING/U-box superfamily protein...		Lus10005617 [exp]	0	1
AT5G12890			UDP-Glycosyltransferase superf...		Lus10031819 [exp]	1.0	0.9095
AT1G53920		GLIP5	GDSL-motif lipase 5 (.1)		Lus10013185 [exp]	4.9	0.8880
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10025819 [exp]	6.2	0.8961
AT5G01410		PDX1, ATPDX1.3,...	REDUCED SUGAR RESPONSE 4, ARAB...		Lus10036181 [exp]	11.0	0.8792
AT4G01850		AtSAM2, SAM-2, ...	S-adenosylmethionine synthetas...		Lus10010070 [exp]	11.5	0.8948
AT4G16490			ARM repeat superfamily protein...		Lus10039047 [exp]	12.4	0.8663
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Lus10017540 [exp]	14.5	0.8336
AT4G32020			unknown protein		Lus10005344 [exp]	15.7	0.8841
AT1G58330		ZW2	transcription factor-related (...		Lus10005041 [exp]	16.4	0.8673
AT3G23150		ETR2	ethylene response 2, Signal tr...		Lus10022203 [exp]	16.6	0.8875

Compare expression of checked genes

Lus10005617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.