Lus10005621 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76060 164 / 2e-52 EMB1793 EMBRYO DEFECTIVE 1793, LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017248 240 / 3e-82 AT1G76060 194 / 3e-64 EMBRYO DEFECTIVE 1793, LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G016600 177 / 1e-57 AT1G76060 196 / 3e-65 EMBRYO DEFECTIVE 1793, LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0491 LYR-like PF05347 Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence
>Lus10005621 pacid=23157208 polypeptide=Lus10005621 locus=Lus10005621.g ID=Lus10005621.BGIv1.0 annot-version=v1.0
ATGACGATGACAATCAAGCTCCAGAAATGGAAGAATCTAGCGATCTCGGTCAACCATACAGTACGGGGCAGCAGGGCTCTTAACCGGCGGCATATACACG
AAGGTCCGGACACCTTGGAGGAGTTGTTGGAGAGGCATGTGGCGAAGAACAAAGAGACTACGTCGTCGCTAGACGAAGAAGAGGAAGAGCTACTGAACCG
CAGAAGATTGACGAGCACGCGGCGAGAGGCGCTGCATCTGTACAGGGACATCTTGAGGGCGACGCGGTTCTTCGTGTGGCCAGACACTCGCGGGGTGATG
TGGAGGGACGTGCTGAGAGAGAACGCGAGGAAGGAGTTTGACGAAGCTCGGTTCGAGAAGGATCCGGAGATCGTGACGCAGCTTCTCATAAATGGCCGAG
ACGCCGTGGAATCTGCTCTGGAGAAGCTCGCCGAGAAGCAGAGACTGCAGATTGAGAAAGAGCGCGGCGGAAATGGAGGATTCGGCTGCTGA
AA sequence
>Lus10005621 pacid=23157208 polypeptide=Lus10005621 locus=Lus10005621.g ID=Lus10005621.BGIv1.0 annot-version=v1.0
MTMTIKLQKWKNLAISVNHTVRGSRALNRRHIHEGPDTLEELLERHVAKNKETTSSLDEEEEELLNRRRLTSTRREALHLYRDILRATRFFVWPDTRGVM
WRDVLRENARKEFDEARFEKDPEIVTQLLINGRDAVESALEKLAEKQRLQIEKERGGNGGFGC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Lus10005621 0 1
AT3G20890 RNA-binding (RRM/RBD/RNP motif... Lus10030139 1.7 0.8776
AT2G35330 RING/U-box superfamily protein... Lus10000899 2.6 0.8602
AT3G21740 APO4 ACCUMULATION OF PHOTOSYSTEM ON... Lus10039659 2.8 0.8700
AT3G07090 PPPDE putative thiol peptidase... Lus10038168 3.5 0.8793
AT2G35900 unknown protein Lus10021249 4.2 0.8626
AT2G03690 coenzyme Q biosynthesis Coq4 f... Lus10026673 4.5 0.8784
AT1G16210 unknown protein Lus10022649 6.3 0.8655
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Lus10023928 6.5 0.8383
AT5G03370 acylphosphatase family (.1) Lus10026533 6.6 0.8449
AT2G36780 UDP-Glycosyltransferase superf... Lus10023939 7.7 0.8396

Lus10005621 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.