Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76065 121 / 5e-38 LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G181400 [exp] 122 / 4e-38 AT1G76065 120 / 1e-37 LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0491 [flax] [poplar] LYR-like PF05347 [flax] [poplar] Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence Show only first row Show all	>Lus10005622 pacid=23157194 polypeptide=Lus10005622 locus=Lus10005622.g ID=Lus10005622.BGIv1.0 annot-version=v1.0 ATGGTTGGCACTTTGGATTTGCAGGGCTTCATTGTTCGAGCTAGAGTACTGAAGCTGTACAGGCAAGCACTGCGGGTTGTGAGTAGAGCGCCTATTTATT CTAGAGATGAACTGAAGCAAACAATTAGGCAGGAAATGGAGAACAACCGGAATTGCAAAGACAAGCAGAGGATTCGGTTTCTGATGAGTGACGGATTAGA GAGACTGAAACGATTGGATGAGATGTTGGATATGCAAGGTCGTTGA
AA sequence Show only first row Show all	>Lus10005622 pacid=23157194 polypeptide=Lus10005622 locus=Lus10005622.g ID=Lus10005622.BGIv1.0 annot-version=v1.0 MVGTLDLQGFIVRARVLKLYRQALRVVSRAPIYSRDELKQTIRQEMENNRNCKDKQRIRFLMSDGLERLKRLDEMLDMQGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76065			LYR family of Fe/S cluster bio...		Lus10005622 [exp]	0	1
AT2G19740			Ribosomal protein L31e family ...		Lus10018032 [exp]	6.6	0.7843
AT1G47278			unknown protein		Lus10016567 [exp]	11.2	0.7312
AT4G18100			Ribosomal protein L32e (.1)		Lus10004589 [exp]	11.9	0.7537
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10016431 [exp]	15.6	0.7417
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	16.5	0.7373
AT3G13230			RNA-binding KH domain-containi...		Lus10027099 [exp]	19.0	0.7077
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10039077 [exp]	19.8	0.6713
AT3G05560			Ribosomal L22e protein family ...		Lus10006509 [exp]	19.9	0.7365
AT4G18100			Ribosomal protein L32e (.1)		Lus10031699 [exp]	24.0	0.7293
AT3G11510			Ribosomal protein S11 family p...		Lus10014220 [exp]	25.5	0.7236

Compare expression of checked genes

Lus10005622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.