Lus10005629 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004154 366 / 2e-128 AT5G11880 53 / 2e-07 Pyridoxal-dependent decarboxylase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G246300 254 / 5e-84 AT3G14390 58 / 6e-09 Pyridoxal-dependent decarboxylase family protein (.1)
Potri.002G015800 241 / 4e-79 AT5G11880 54 / 1e-07 Pyridoxal-dependent decarboxylase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0036 TIM_barrel PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain
CL0036 PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
Representative CDS sequence
>Lus10005629 pacid=23157227 polypeptide=Lus10005629 locus=Lus10005629.g ID=Lus10005629.BGIv1.0 annot-version=v1.0
ATGCAGTCGGACGGATCTTTTAGCGATACGGCTTTTCGGCTCGGGATGCCGCGAATGCACATGCTGGACATTGGGGGAGGTTTCACCTCCGGCTCGCAAT
TCGAAGATGCAGCTACGGAAATCCGAGCCGCGCTGGATGAGTATTTCTTAGGGGAGCCGGGTCTGAAGGTGATAAGCGAGCCCGGTCGGTTCTTTTCGGA
ATCTGCTTTCACTTTAGCGGCCACGATCATCGGGAAGCGCGTGAGGGGAGGGCAACGGGAGTATTGGATAAACGACGGCCTTTACGGGTCGATGAATTGC
ATTCTTTACGACCACGCGACCGTTAGGTGCGCGCCTTTGGCGTTAGTTTCAAACCCTGGGGACCCTACGTGCGAAGTGGCGGCGGCCAAGTACAGCTCGA
CGGTGTTTGGTCCCACGTGCGACGCCCTTGACACGGTGTTCACTGGGCGGCTGCTGCCGGAGCTTAAGGTCAATGACTGGCTAGTGTTTCCGGGCATGGG
GGCCTATACGGCGGCTGCCGGGTCAAACTTTAATGGGTTCAATGCTGATCGAATTTTGACTCATCTTGCCTACACTACTACTACTGTTAATCCCAATTGA
AA sequence
>Lus10005629 pacid=23157227 polypeptide=Lus10005629 locus=Lus10005629.g ID=Lus10005629.BGIv1.0 annot-version=v1.0
MQSDGSFSDTAFRLGMPRMHMLDIGGGFTSGSQFEDAATEIRAALDEYFLGEPGLKVISEPGRFFSESAFTLAATIIGKRVRGGQREYWINDGLYGSMNC
ILYDHATVRCAPLALVSNPGDPTCEVAAAKYSSTVFGPTCDALDTVFTGRLLPELKVNDWLVFPGMGAYTAAAGSNFNGFNADRILTHLAYTTTTVNPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005629 0 1
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10025902 2.0 0.9957
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008917 3.2 0.9926
AT3G26230 CYP71B24 "cytochrome P450, family 71, s... Lus10019461 3.7 0.9939
AT3G48320 CYP71A21 "cytochrome P450, family 71, s... Lus10019460 4.6 0.9938
AT2G40620 bZIP AtbZIP18 Basic-leucine zipper (bZIP) tr... Lus10030531 6.0 0.9926
AT1G14550 Peroxidase superfamily protein... Lus10009900 6.7 0.9901
Lus10014508 7.7 0.9924
AT3G48320 CYP71A21 "cytochrome P450, family 71, s... Lus10043311 8.8 0.9924
AT1G13080 CYP71B2 "cytochrome P450, family 71, s... Lus10043312 9.2 0.9907
AT4G15560 AtCLA1, DXS, DX... 1-DEOXY-D-XYLULOSE 5-PHOSPHATE... Lus10012724 10.1 0.9899

Lus10005629 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.