Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66040 144 / 1e-44 STR16 sulfurtransferase protein 16 (.1.2) AT4G35770 142 / 5e-43 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) AT5G66170 110 / 5e-31 STR18 sulfurtransferase 18 (.1.2.3) AT2G17850 89 / 1e-22 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G21045 89 / 2e-22 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G27700 60 / 4e-11 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G42220 49 / 3e-07 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G24750 47 / 2e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021227 [exp] 270 / 1e-93 AT5G66040 73 / 4e-17 sulfurtransferase protein 16 (.1.2) Lus10012566 [exp] 216 / 2e-72 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2) Lus10041525 [exp] 207 / 2e-66 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4) Lus10028390 [exp] 162 / 5e-51 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10041843 [exp] 159 / 2e-49 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10041894 [exp] 83 / 3e-20 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3) Lus10041895 [exp] 82 / 2e-19 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3) Lus10028442 [exp] 77 / 2e-17 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3) Lus10028441 [exp] 69 / 4e-15 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G014900 [exp] 165 / 4e-52 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.005G106400 [exp] 155 / 3e-47 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.005G111200 [exp] 110 / 7e-31 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.014G131300 [exp] 107 / 4e-30 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G008000 [exp] 61 / 3e-11 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.012G020700 [exp] 59 / 1e-10 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G059200 [exp] 49 / 3e-07 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G100600 [exp] 47 / 1e-06 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.009G069300 [exp] 43 / 6e-05 AT5G19370 281 / 3e-94 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1) Potri.015G086100 [exp] 42 / 0.0001 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF00581 [flax] [poplar] Rhodanese Rhodanese-like domain
Representative CDS sequence Show only first row Show all	>Lus10005635 pacid=23157213 polypeptide=Lus10005635 locus=Lus10005635.g ID=Lus10005635.BGIv1.0 annot-version=v1.0 ATGGCGGCGGCTTCGGCTTCTCTCCTTCTAAGGTTCCAGAACCCTTCCATCACTGGGCGTCTCCGTCCGTCAATCCGAATGGCGTACTGTCAAGTCTTGC AAGGGAGAGACATTAGAATCGCCAACTTTGGGTGTGTTTTTCCTATGCATTCTGCCTCCATGCTTTTCCAGGCATTTAATTTTAATCAATCCATGTTCAC TACAATAGCTAATGGACGGACTCAGCCGCCGTCACCGAGTTCGGTGGCTGTTCTGGCAGCATACCAGCTCCTGGTTAAAGGGCACAGGTATTTGGATGTC AGATCTTGTGAGGAGTTCAATGCAGGTCATCCAACTGGAGCTGTGAACATTCCTTACCTACTCAACAAAGGAGCTGACATGTCTAAGAATCCCAAGTTTC TGGATGAAGTATCGTCCAAGTTTAACAAGCAAGACGAAATCCTAGTTGGTTGTCAGAGTGGAAGGAGGTCACTCATGGCTGCAGCTGATATGCAAACTGC TGGGTTTACAAGCGTGGTTGATGTTGCTGGCGGCTATAACTCATGGATTCAAAACGGATTACCCACCACAACTAAATAG
AA sequence Show only first row Show all	>Lus10005635 pacid=23157213 polypeptide=Lus10005635 locus=Lus10005635.g ID=Lus10005635.BGIv1.0 annot-version=v1.0 MAAASASLLLRFQNPSITGRLRPSIRMAYCQVLQGRDIRIANFGCVFPMHSASMLFQAFNFNQSMFTTIANGRTQPPSPSSVAVLAAYQLLVKGHRYLDV RSCEEFNAGHPTGAVNIPYLLNKGADMSKNPKFLDEVSSKFNKQDEILVGCQSGRRSLMAAADMQTAGFTSVVDVAGGYNSWIQNGLPTTTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66040		STR16	sulfurtransferase protein 16 (...		Lus10005635 [exp]	0	1
AT4G37560			Acetamidase/Formamidase family...		Lus10019293 [exp]	1.4	0.8891
AT2G20030			RING/U-box superfamily protein...		Lus10009511 [exp]	3.6	0.8952
AT5G35200			ENTH/ANTH/VHS superfamily prot...		Lus10003642 [exp]	16.5	0.8590
AT3G12720	MYB	ATMYB67, AtY53	myb domain protein 67 (.1)		Lus10001226 [exp]	20.2	0.8096
					Lus10012862 [exp]	20.5	0.7831
AT3G05640			Protein phosphatase 2C family ...		Lus10037709 [exp]	22.6	0.8745
AT5G52790			CBS domain-containing protein ...		Lus10039289 [exp]	25.8	0.8472
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Lus10016749 [exp]	30.5	0.8436
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10018262 [exp]	31.0	0.8702
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10032347 [exp]	31.1	0.8701

Compare expression of checked genes

Lus10005635 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.