Lus10005638 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40410 306 / 6e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 251 / 1e-78 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G29760 250 / 2e-78 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G26782 249 / 2e-78 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14850 247 / 1e-77 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G12770 245 / 9e-77 MEF22 mitochondrial editing factor 22 (.1)
AT2G01510 242 / 1e-76 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G33990 247 / 2e-76 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13770 243 / 2e-76 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 245 / 4e-76 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021229 495 / 5e-174 AT5G40410 662 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016387 266 / 6e-87 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000117 253 / 5e-83 AT4G21065 404 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10019735 263 / 9e-83 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006073 259 / 2e-82 AT1G71420 471 / 1e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006628 248 / 6e-81 AT4G21065 399 / 7e-137 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10039388 253 / 1e-80 AT5G43790 506 / 8e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009437 256 / 3e-80 AT1G71420 753 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010998 255 / 3e-80 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G014800 373 / 4e-127 AT5G40410 749 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G220300 257 / 4e-81 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G050200 254 / 8e-81 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G105700 255 / 1e-80 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G128900 255 / 1e-80 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G001200 247 / 1e-78 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G051300 248 / 4e-78 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G466066 250 / 8e-78 AT4G33990 1067 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G044700 249 / 8e-78 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G191000 250 / 1e-77 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10005638 pacid=23157206 polypeptide=Lus10005638 locus=Lus10005638.g ID=Lus10005638.BGIv1.0 annot-version=v1.0
ATGTCATCATACTATGGAGTTGAGCCGATGATCGATCACTATTCATGCATGGTCGACCTCTTGGGCCGAGCTGGATTTCTGAACGATGCTTACCAGCTCA
TTAGAACCATGCCAATGAAGCCAAATTCTGGTGTTTGGGGAGCTCTAATGGGTGCTTGCAGGAAACATGGCAACATTGAGCTTGGGAAGGAAGTGTTTGA
CAACTTGTTTGCTTTAGACCCATCAGACTCCAGAAACTACATCTCCTTATCAAATATGTACGCTGCTGCTGGTCTTCTGAACGAAGCTTCCAAGGTGAGG
TCACTTATGAAGGAAACAAGTGTGGTCCAGAACCCAGGTTCAAGTTCCATAGAACATGGAAACAAGATTAATGTATTTGTTTCAGGTGATCAATCTCATC
CTCTGAGAGAAGAGATATATAACAAGTTGGAAGAAATTATTCGCAAGATCCGGGGAAATGGGATATCGGCAAAGACAGAGCTCGTACTACAGGATATTGA
TGATGAGGAGGTGAAAGAGGAGATGATCAACAAACACAGTGAAAAGCTAGCCATTGCATTTGGGCTCCTGGTGAATGGTCAAAATGCAATGCCTCTGGTT
ATAACCAAGAACCTGAGGATATGTGGCGACTGTCATAACTTTGCTAAGGTGGTGTCGGGGATGGAGGATCGCGAGATTATTGTCCGAGATACAAAGCGAT
TTCACCACTTCGCCAATGGATTATGCTCTTGCAGAGACTACTGGTAA
AA sequence
>Lus10005638 pacid=23157206 polypeptide=Lus10005638 locus=Lus10005638.g ID=Lus10005638.BGIv1.0 annot-version=v1.0
MSSYYGVEPMIDHYSCMVDLLGRAGFLNDAYQLIRTMPMKPNSGVWGALMGACRKHGNIELGKEVFDNLFALDPSDSRNYISLSNMYAAAGLLNEASKVR
SLMKETSVVQNPGSSSIEHGNKINVFVSGDQSHPLREEIYNKLEEIIRKIRGNGISAKTELVLQDIDDEEVKEEMINKHSEKLAIAFGLLVNGQNAMPLV
ITKNLRICGDCHNFAKVVSGMEDREIIVRDTKRFHHFANGLCSCRDYW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40410 Tetratricopeptide repeat (TPR)... Lus10005638 0 1
AT5G27740 RFC3, EMB251, E... replication factor C 3, EMBRYO... Lus10043248 8.1 0.7339
AT4G18593 dual specificity protein phosp... Lus10001888 16.6 0.6730
AT4G35380 SEC7-like guanine nucleotide e... Lus10022975 17.1 0.6632
AT3G55080 SET domain-containing protein ... Lus10040345 17.1 0.6784
AT1G80880 Tetratricopeptide repeat (TPR)... Lus10041669 31.0 0.6579
AT2G22600 RNA-binding KH domain-containi... Lus10002662 31.9 0.6492
Lus10042733 34.0 0.6183
AT2G34930 disease resistance family prot... Lus10016337 36.4 0.6244
AT1G07230 NPC1 non-specific phospholipase C1 ... Lus10018228 37.5 0.6277
AT1G56570 PGN PENTATRICOPEPTIDE REPEAT PROTE... Lus10019891 39.2 0.6313

Lus10005638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.