Lus10005646 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15060 57 / 2e-09 unknown protein
AT1G80960 56 / 4e-09 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
AT3G03360 53 / 3e-08 F-box/RNI-like superfamily protein (.1)
AT1G69630 50 / 3e-07 F-box/RNI-like superfamily protein (.1)
AT5G60610 48 / 1e-06 F-box/RNI-like superfamily protein (.1)
AT1G49610 48 / 1e-06 F-box family protein (.1)
AT1G16930 48 / 2e-06 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G03100 47 / 4e-06 F-box/RNI-like superfamily protein (.1)
AT1G78730 47 / 5e-06 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1)
AT5G02910 46 / 8e-06 F-box/RNI-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028722 120 / 6e-32 AT2G42730 76 / 1e-14 F-box family protein (.1.2)
Lus10018863 112 / 2e-30 AT5G44950 62 / 1e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10011268 105 / 3e-28 AT5G41630 52 / 7e-08 F-box/RNI-like superfamily protein (.1)
Lus10028558 75 / 3e-17 AT3G51530 56 / 4e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10028721 72 / 6e-16 AT5G53840 56 / 5e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10003089 67 / 2e-13 AT5G53840 54 / 3e-08 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10028602 62 / 2e-11 AT1G80960 50 / 1e-06 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Lus10005091 61 / 9e-11 AT1G69010 149 / 5e-41 BES1-interacting Myc-like protein 2 (.1)
Lus10029587 41 / 0.0004 AT5G02930 74 / 3e-14 F-box/RNI-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G098700 51 / 1e-07 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3)
Potri.011G024200 43 / 9e-05 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.001G322900 42 / 0.0002 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10005646 pacid=23157228 polypeptide=Lus10005646 locus=Lus10005646.g ID=Lus10005646.BGIv1.0 annot-version=v1.0
ATGTATTTGTTTCTCAGAAAACGCAGTGGAGCCATGTTTTCTGCCGCTCTCCTTCGGCGATTCTCTCTCTTCCAGAGAACTATGCCGTCTTCTAACACTA
TTGAGTCTACAGAAGAAGAATCAAAGGAAGGAGACTTGGATTGGATTAGTAAGTTGCCTGATGAACTACTTGTGAAAGTGGTGTCTCGTTTGAGCATGAA
GGAAGCAATCAGAACTTCAGCAGTCTCGAGAAGGTTGGAAGATTTGTGGAAATTTGCAGACTTGGAATTGGACTTCGATGCTACCGATGAGTTGGTTGTA
GATAAGCTAGGAATCAATTTCAGTTTACCTCCTGAACAGAGAAAGCGGTTCCACAATCGGGTGAATGGGGTTGTGATCCAGCTGATGCAGACCCCAAAAC
TAGGCAAATTTAGAGTCTTTTACCAGTTGAATAAAGAAGAAGCCTCCAATTCCAAGGAAATGGAGGATATTGACACATGGCTCGACTTCGCCATATTGAA
GAGAGTCGAGTCTCTTCATCTATCGTTCAATCTCATCCATCCTGGCCGCATACCTCACTATGTTTTCTCTGAGAAATGCTACAAACACGTCCAGACGTCT
CCAGCTAAGCAGCTTAGATCATTATGA
AA sequence
>Lus10005646 pacid=23157228 polypeptide=Lus10005646 locus=Lus10005646.g ID=Lus10005646.BGIv1.0 annot-version=v1.0
MYLFLRKRSGAMFSAALLRRFSLFQRTMPSSNTIESTEEESKEGDLDWISKLPDELLVKVVSRLSMKEAIRTSAVSRRLEDLWKFADLELDFDATDELVV
DKLGINFSLPPEQRKRFHNRVNGVVIQLMQTPKLGKFRVFYQLNKEEASNSKEMEDIDTWLDFAILKRVESLHLSFNLIHPGRIPHYVFSEKCYKHVQTS
PAKQLRSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80960 F-box and Leucine Rich Repeat ... Lus10005646 0 1
AT4G31340 myosin heavy chain-related (.1... Lus10041099 6.5 0.6263
AT4G39810 Polynucleotidyl transferase, r... Lus10022503 15.2 0.6724
AT2G26600 Glycosyl hydrolase superfamily... Lus10038099 28.2 0.6567
AT5G24320 Transducin/WD40 repeat-like su... Lus10023033 29.3 0.6396
AT3G19640 MRS2-3, MGT4 magnesium transporter 4 (.1) Lus10026745 29.3 0.5623
Lus10040594 37.1 0.6091
AT3G63380 ATPase E1-E2 type family prote... Lus10004086 84.3 0.6123
AT5G36930 Disease resistance protein (TI... Lus10042714 159.1 0.5801
AT4G29940 HD PRHA pathogenesis related homeodoma... Lus10015536 176.3 0.5729
AT3G04910 ATWNK1, ZIK4, W... with no lysine (K) kinase 1 (.... Lus10020236 198.4 0.5564

Lus10005646 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.