Lus10005647 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021237 110 / 1e-30 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005647 pacid=23157234 polypeptide=Lus10005647 locus=Lus10005647.g ID=Lus10005647.BGIv1.0 annot-version=v1.0
ATGCTTCGGTATTTTTCCAGCTATGCTCCTCAGCTGGAGGCCCTTGGCCTGGAAATAGTGCCCCAGTACATGCCGCTGGTTGATGAGGTGGTGGAACACA
CTCGCCTTGAGGGGCTAAGAGTGGGAGTTTTGGTTGATGGGAATAGCTATCTTCTTAGATTGATTCCCTTGATCAATGCCTCGTTTCCACACGCTGCAAT
TTTGCATTCTTACCCTGGCACATTCGACTTCCGTCTAGCGCATGCCGTCGAAAAGGTCTTGGCGTTTCCCGCAGTTGTGCTTGCCGACGACCACGACATA
ACCGCGGGAGATACTCTGGTCAGGGAGAGACCTTCGTGGAATGACACCAAGTTCTCGTTCTATTCAGGCTTACAGGCCGCTGAGGTTTCAAGGCTGAGGG
GAAAAAAGTACTAA
AA sequence
>Lus10005647 pacid=23157234 polypeptide=Lus10005647 locus=Lus10005647.g ID=Lus10005647.BGIv1.0 annot-version=v1.0
MLRYFSSYAPQLEALGLEIVPQYMPLVDEVVEHTRLEGLRVGVLVDGNSYLLRLIPLINASFPHAAILHSYPGTFDFRLAHAVEKVLAFPAVVLADDHDI
TAGDTLVRERPSWNDTKFSFYSGLQAAEVSRLRGKKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005647 0 1
AT1G73440 calmodulin-related (.1) Lus10009280 8.8 0.6751
AT3G28345 MDR13, ABCB15 multi-drug resistance 13, ATP-... Lus10012959 11.0 0.7143
AT3G57810 Cysteine proteinases superfami... Lus10037002 16.5 0.7274
AT4G13780 methionine--tRNA ligase, putat... Lus10010450 17.5 0.6963
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Lus10020392 26.8 0.7048
AT3G07450 Bifunctional inhibitor/lipid-t... Lus10030541 28.2 0.5866
AT1G60730 NAD(P)-linked oxidoreductase s... Lus10037408 32.0 0.6431
AT1G52240 PIRF1, ATROPGEF... phytochrome interacting RopGEF... Lus10025794 35.0 0.6633
AT5G59880 ADF3 actin depolymerizing factor 3 ... Lus10025318 36.6 0.6836
AT3G29280 unknown protein Lus10018197 38.7 0.6795

Lus10005647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.