Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44990 139 / 1e-39 MAX3, CCD7, ATCCD7 carotenoid cleavage dioxygenase 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021241 [exp] 196 / 1e-60 AT2G44990 701 / 0.0 carotenoid cleavage dioxygenase 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G056800 [exp] 160 / 2e-47 AT2G44990 779 / 0.0 carotenoid cleavage dioxygenase 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03055 [flax] [poplar] RPE65 Retinal pigment epithelial membrane protein
Representative CDS sequence Show only first row Show all	>Lus10005653 pacid=23157200 polypeptide=Lus10005653 locus=Lus10005653.g ID=Lus10005653.BGIv1.0 annot-version=v1.0 ATGGCCGCTTTCTGGGACTACCAGTTCCTCATCATGTCCCAGCGATCCGAGACAACCCACCGGACCACCCTCCGAGTGGTGGACGGCGAAGTTCCCTCCG ACTTCCCCGCGGGGACATACTACCTGGCCGGACCGGGACTCTTCAGCGACGACCACGGGTCAACGGTGCACCCTCTCGACACCCACGGCTACGTCAAGTC GTTTGGGATCATGGAAGAAGGGACGAAGAAAGTGGTGTCGTACATGGCCAAGTACGTAAAGACAGAGGCGCAGATGGAGGAGCACGACCCCGTAACTGAC ATGTGGCGTTCACTCGCAGGGGACCCTTCTCGTTGCTGA
AA sequence Show only first row Show all	>Lus10005653 pacid=23157200 polypeptide=Lus10005653 locus=Lus10005653.g ID=Lus10005653.BGIv1.0 annot-version=v1.0 MAAFWDYQFLIMSQRSETTHRTTLRVVDGEVPSDFPAGTYYLAGPGLFSDDHGSTVHPLDTHGYVKSFGIMEEGTKKVVSYMAKYVKTEAQMEEHDPVTD MWRSLAGDPSRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44990		MAX3, CCD7, ATC...	carotenoid cleavage dioxygenas...		Lus10005653 [exp]	0	1
AT3G52710			unknown protein		Lus10022708 [exp]	6.0	0.7702
AT2G36220			unknown protein		Lus10022709 [exp]	6.5	0.7721
AT3G61260			Remorin family protein (.1)		Lus10039215 [exp]	9.7	0.7640
AT2G04780		FLA7	FASCICLIN-like arabinoogalacta...		Lus10012351 [exp]	11.1	0.7644
AT5G56600		PRF3, PFN3	profilin 3 (.1.2)		Lus10043040 [exp]	14.7	0.7459
AT5G27930			Protein phosphatase 2C family ...		Lus10015206 [exp]	16.4	0.7322
AT1G07750			RmlC-like cupins superfamily p...		Lus10015219 [exp]	17.1	0.7814
AT2G45140		PVA12	plant VAP homolog 12 (.1)		Lus10008512 [exp]	17.3	0.7210
AT3G11900		ANT1	aromatic and neutral transport...		Lus10021089 [exp]	18.2	0.7068
AT1G21380			Target of Myb protein 1 (.1)		Lus10018948 [exp]	19.6	0.7378

Compare expression of checked genes

Lus10005653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.