Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35840 77 / 4e-18 Sucrose-6F-phosphate phosphohydrolase family protein (.1.2.3) AT1G51420 71 / 1e-15 ATSPP1 sucrose-phosphatase 1 (.1) AT3G54270 69 / 3e-15 sucrose-6F-phosphate phosphohydrolase family protein (.1) AT3G52340 66 / 6e-14 ATSPP2, SPP2 SUCROSE-PHOSPHATASE 2, sucrose-6F-phosphate phosphohydrolase 2 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012284 [exp] 108 / 9e-29 AT5G06530 802 / 0.0 Arabidopsis thaliana ATP-binding cassette G22, ATP-binding cassette G22, ABC-2 type transporter family protein (.1.2.3) Lus10015995 [exp] 101 / 1e-26 AT2G35840 602 / 0.0 Sucrose-6F-phosphate phosphohydrolase family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G199800 [exp] 89 / 4e-22 AT2G35840 633 / 0.0 Sucrose-6F-phosphate phosphohydrolase family protein (.1.2.3) Potri.016G066100 [exp] 84 / 2e-20 AT2G35840 624 / 0.0 Sucrose-6F-phosphate phosphohydrolase family protein (.1.2.3) Potri.008G013300 [exp] 69 / 3e-15 AT2G35840 547 / 0.0 Sucrose-6F-phosphate phosphohydrolase family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0137 [flax] [poplar] HAD PF05116 [flax] [poplar] S6PP Sucrose-6F-phosphate phosphohydrolase
Representative CDS sequence Show only first row Show all	>Lus10005654 pacid=23157223 polypeptide=Lus10005654 locus=Lus10005654.g ID=Lus10005654.BGIv1.0 annot-version=v1.0 ATGGAGTTATGGAGTGTAAATGGCAGACATATTGTCCTCGCCCCTCCTCAACTTGCTAACCAACCATATTTGACGAAATATTTGGATGAACGAGTTGAAG GCGACAGAACATTTGCAATTGACCGCTTCAAGGAACCTGCTCAGCTTATGATAGTCTCGTACCTTCATCATACCATGGTTGATCACCATCATAAGGAGAA CATGTCTTTCCTCAGGTTCAATGCTTTGTGGGAAGCCCACTACAGATTTGATTCCCTGCTGATTTTCTCCACCGGAATGGTCGCCTAA
AA sequence Show only first row Show all	>Lus10005654 pacid=23157223 polypeptide=Lus10005654 locus=Lus10005654.g ID=Lus10005654.BGIv1.0 annot-version=v1.0 MELWSVNGRHIVLAPPQLANQPYLTKYLDERVEGDRTFAIDRFKEPAQLMIVSYLHHTMVDHHHKENMSFLRFNALWEAHYRFDSLLIFSTGMVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35840			Sucrose-6F-phosphate phosphohy...		Lus10005654 [exp]	0	1
AT4G02630			Protein kinase superfamily pro...		Lus10024813 [exp]	12.5	0.7494
AT5G12320			ankyrin repeat family protein ...		Lus10009696 [exp]	16.0	0.7939
AT1G13770		RUS3	ROOT UV-B SENSITIVE 3, Protein...		Lus10036909 [exp]	24.8	0.7879
AT3G49645			unknown protein		Lus10002833 [exp]	32.4	0.7598
AT1G16890		UBC36 ,UBC13B	UBIQUITIN CONJUGATING ENZYME 1...		Lus10000353 [exp]	33.4	0.7812
AT3G07020		UGT80A2, SGT	UDP-glucosyl transferase 80A2,...		Lus10022815 [exp]	45.2	0.7605
AT1G16760			Protein kinase protein with ad...		Lus10008609 [exp]	46.6	0.7487
AT5G65960			GTP binding (.1)		Lus10016687 [exp]	49.6	0.7692
AT5G18540			unknown protein		Lus10033960 [exp]	52.2	0.7567
AT2G30280		RDM4, DMS4	DEFECTIVE IN MERISTEM SILENCIN...		Lus10035851 [exp]	54.6	0.7704

Compare expression of checked genes

Lus10005654 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.