Lus10005655 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009517 276 / 4e-95 AT1G22440 92 / 2e-21 Zinc-binding alcohol dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G041600 48 / 9e-07 AT1G22430 300 / 3e-99 GroES-like zinc-binding dehydrogenase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00107 ADH_zinc_N Zinc-binding dehydrogenase
Representative CDS sequence
>Lus10005655 pacid=23168865 polypeptide=Lus10005655 locus=Lus10005655.g ID=Lus10005655.BGIv1.0 annot-version=v1.0
ATGGCCATGGAACTGGGGGCCACCCACTGCATCAACTCCGAGAAACTACCCGAGGGGGTCACCCCTTCGCAAGCGGTTAGGAAACTCACCCCCAAGGAAG
TCGGAGTCGATGCGAGCATCGAATCCTCGGGCTACGACGTCTTCATGAACGAAGCCATGAAAGCCGCCATCCACGGGAAAGCCAAGACCGTGATTACCGG
AGAAGGAATTTACGAAAACGACAGAATCTTCTTCGATTTCAAGGACTTCCTGTTCGGCGGGAACGTAGTCGGAAACGTCACGGGTCGGGTTAGAATCCAT
AGCGATTTCCCAGGGTTGCTGAGAAAGGCTCAAGAACCGGTAATCAGAGCTGGAATGGATAAAATCTTGGGGTACGATGCGGCAACTATGAAGTGCAAGT
ACGAGGTCGACATTCGTGAGGGTACTCCTGCATTACTGAAAGCATTGGAAGAGGTGGAGAATGTGGATTGCGTCAAACTCGTGATCAAGTTGAACGATTA
TTGA
AA sequence
>Lus10005655 pacid=23168865 polypeptide=Lus10005655 locus=Lus10005655.g ID=Lus10005655.BGIv1.0 annot-version=v1.0
MAMELGATHCINSEKLPEGVTPSQAVRKLTPKEVGVDASIESSGYDVFMNEAMKAAIHGKAKTVITGEGIYENDRIFFDFKDFLFGGNVVGNVTGRVRIH
SDFPGLLRKAQEPVIRAGMDKILGYDAATMKCKYEVDIREGTPALLKALEEVENVDCVKLVIKLNDY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005655 0 1
AT1G22430 GroES-like zinc-binding dehydr... Lus10005656 1.0 0.9921
AT5G56350 Pyruvate kinase family protein... Lus10003439 8.0 0.9338
AT4G29990 Leucine-rich repeat transmembr... Lus10038251 8.7 0.9227
AT4G16260 Glycosyl hydrolase superfamily... Lus10016883 13.0 0.9111
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10024511 13.0 0.9281
AT2G02010 GAD4 glutamate decarboxylase 4 (.1) Lus10019136 16.2 0.9054
AT4G29680 Alkaline-phosphatase-like fami... Lus10034660 20.7 0.9244
AT5G08380 ATAGAL1 alpha-galactosidase 1 (.1) Lus10017365 26.5 0.8775
AT3G26270 CYP71B25 "cytochrome P450, family 71, s... Lus10019463 26.6 0.9062
AT2G43900 Endonuclease/exonuclease/phosp... Lus10027073 29.0 0.8314

Lus10005655 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.