Lus10005667 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03590 104 / 2e-29 SWIB/MDM2 domain superfamily protein (.1)
AT2G35605 100 / 3e-28 SWIB/MDM2 domain superfamily protein (.1)
AT2G14880 97 / 1e-26 SWIB/MDM2 domain superfamily protein (.1)
AT4G34290 95 / 6e-26 SWIB/MDM2 domain superfamily protein (.1)
AT1G31760 93 / 2e-25 SWIB/MDM2 domain superfamily protein (.1)
AT1G49520 70 / 7e-15 SWIB complex BAF60b domain-containing protein (.1)
AT4G26810 66 / 7e-15 SWIB/MDM2 domain superfamily protein (.1.2)
AT4G22360 67 / 7e-14 SWIB complex BAF60b domain-containing protein (.1)
AT3G19080 67 / 7e-14 SWIB complex BAF60b domain-containing protein (.1)
AT3G48600 59 / 2e-11 SWIB complex BAF60b domain-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013893 96 / 5e-26 AT2G14880 143 / 7e-45 SWIB/MDM2 domain superfamily protein (.1)
Lus10002106 88 / 7e-24 AT4G34290 109 / 2e-32 SWIB/MDM2 domain superfamily protein (.1)
Lus10019640 69 / 2e-14 AT3G19080 256 / 2e-81 SWIB complex BAF60b domain-containing protein (.1)
Lus10033312 64 / 6e-14 AT2G35605 68 / 6e-16 SWIB/MDM2 domain superfamily protein (.1)
Lus10034774 64 / 6e-14 AT2G35605 68 / 6e-16 SWIB/MDM2 domain superfamily protein (.1)
Lus10014892 66 / 2e-13 AT4G22360 243 / 2e-76 SWIB complex BAF60b domain-containing protein (.1)
Lus10016581 66 / 2e-13 AT4G22360 190 / 1e-55 SWIB complex BAF60b domain-containing protein (.1)
Lus10009333 66 / 3e-13 AT3G19080 266 / 4e-87 SWIB complex BAF60b domain-containing protein (.1)
Lus10038799 60 / 2e-11 AT4G26810 160 / 1e-50 SWIB/MDM2 domain superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G070600 117 / 1e-34 AT2G35605 108 / 2e-31 SWIB/MDM2 domain superfamily protein (.1)
Potri.009G092200 103 / 4e-29 AT2G14880 169 / 7e-55 SWIB/MDM2 domain superfamily protein (.1)
Potri.001G297400 97 / 9e-27 AT2G14880 142 / 3e-44 SWIB/MDM2 domain superfamily protein (.1)
Potri.004G145200 74 / 2e-16 AT1G49520 308 / 6e-103 SWIB complex BAF60b domain-containing protein (.1)
Potri.009G106700 74 / 2e-16 AT1G49520 301 / 5e-100 SWIB complex BAF60b domain-containing protein (.1)
Potri.006G010700 69 / 1e-14 AT4G22360 303 / 2e-100 SWIB complex BAF60b domain-containing protein (.1)
Potri.016G013400 67 / 5e-14 AT4G22360 301 / 1e-99 SWIB complex BAF60b domain-containing protein (.1)
Potri.005G134500 66 / 2e-13 AT3G19080 226 / 3e-70 SWIB complex BAF60b domain-containing protein (.1)
Potri.015G137600 59 / 2e-12 AT4G26810 181 / 1e-60 SWIB/MDM2 domain superfamily protein (.1.2)
Potri.007G039350 51 / 1e-08 AT3G19080 118 / 4e-32 SWIB complex BAF60b domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02201 SWIB SWIB/MDM2 domain
Representative CDS sequence
>Lus10005667 pacid=23168904 polypeptide=Lus10005667 locus=Lus10005667.g ID=Lus10005667.BGIv1.0 annot-version=v1.0
ATGTCTTTCGCAGCTAGGGTTTTCCGAACCTCCCGCCCACTTCTGGCCCCGGCCAAGTCTGCCGCCGCAACCACCTCGACCGCCAAGGTCGCAGCGAAGA
AACCGAAGCGGGCTTCCCCGAAGCCGAAGTCCGACGCTGCGCCGAAGACAACTAGCGGAATACTGAAGCTGGTCACCGTCTCCCCTGAGCTCGGTAGCTT
CCTCGGTGGCGTTCCGGAAGCTTCCAGGACTGACGCCATCAAGAAGATCTGGAGCCACATTAAGGAGCATCAGCTTCAGAACCCGCTGAACAAGAGGGAG
ATCATCTGCGATGACAAGCTGAAGACGATCTTCGCTCAGAAAGAGAGAGTTGAAATGCTGGAGATCGCCAAGCTGCTGTCGCCTCATTTCGAGAAGTCTG
GTTAA
AA sequence
>Lus10005667 pacid=23168904 polypeptide=Lus10005667 locus=Lus10005667.g ID=Lus10005667.BGIv1.0 annot-version=v1.0
MSFAARVFRTSRPLLAPAKSAAATTSTAKVAAKKPKRASPKPKSDAAPKTTSGILKLVTVSPELGSFLGGVPEASRTDAIKKIWSHIKEHQLQNPLNKRE
IICDDKLKTIFAQKERVEMLEIAKLLSPHFEKSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03590 SWIB/MDM2 domain superfamily p... Lus10005667 0 1
AT2G33845 Nucleic acid-binding, OB-fold-... Lus10002172 1.0 0.9154
AT2G32940 AGO6 ARGONAUTE 6, Argonaute family ... Lus10029989 3.5 0.9069
AT3G03920 H/ACA ribonucleoprotein comple... Lus10020289 4.2 0.9023
AT3G13882 Ribosomal protein L34 (.1.2) Lus10015609 5.7 0.8967
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10018191 7.1 0.9089
AT5G52220 unknown protein Lus10038870 7.7 0.8984
AT5G65360 Histone superfamily protein (.... Lus10025439 10.9 0.9102
AT4G18590 Nucleic acid-binding, OB-fold-... Lus10014209 13.9 0.8885
AT4G37090 unknown protein Lus10000742 14.1 0.8800
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10005893 14.7 0.9002

Lus10005667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.