Lus10005678 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27870 146 / 2e-40 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G33230 140 / 2e-38 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G26450 138 / 1e-37 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G05610 138 / 2e-37 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G49180 135 / 8e-37 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G10720 125 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
AT1G02810 129 / 9e-35 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G06830 129 / 1e-34 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02330 129 / 2e-34 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G47550 127 / 4e-34 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020313 328 / 7e-113 AT5G27870 259 / 6e-80 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027656 153 / 2e-44 AT4G33230 499 / 6e-174 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10039927 154 / 2e-43 AT2G26450 598 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10028882 140 / 2e-38 AT5G04970 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10017119 133 / 3e-38 AT4G33230 271 / 2e-87 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10002976 138 / 8e-38 AT2G26450 429 / 2e-144 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10008937 135 / 1e-36 AT3G10720 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
Lus10018335 134 / 3e-36 AT3G05610 446 / 3e-149 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027206 129 / 1e-34 AT2G45220 551 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G010464 145 / 2e-40 AT5G27870 619 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G127000 139 / 4e-38 AT1G02810 712 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.006G134500 134 / 1e-36 AT4G33220 677 / 0.0 A. THALIANA PECTIN METHYLESTERASE 44, pectin methylesterase 44 (.1)
Potri.008G011100 133 / 6e-36 AT3G10720 744 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
Potri.010G247700 131 / 2e-35 AT3G10720 746 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
Potri.013G013400 131 / 2e-35 AT3G05610 580 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.006G134700 131 / 3e-35 AT4G33230 608 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.005G022800 131 / 3e-35 AT4G02330 571 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.018G051200 130 / 4e-35 AT2G26450 634 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G247600 129 / 2e-34 AT3G10710 609 / 0.0 root hair specific 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10005678 pacid=23168898 polypeptide=Lus10005678 locus=Lus10005678.g ID=Lus10005678.BGIv1.0 annot-version=v1.0
ATGTCAATTGACAACAGGGCGAAGAGAGCGGCGGGAAATTCCTCCTCAGCCGCCGCAGTAACGGCGGTGGCGGTTAGAGTTCAGGCGGATAAATCAGCGT
TCTACAACTGCACGATCGAAGGCGGGAAATCAGCTCTCTACGCTTTGGCGCACCGCCAATTCTACAGCGGATGCAAGATTTCCGGATCGGGGGATCTGAT
AATCGGCGATGCAGCGGCGGTGATTCAGGATTCGGAGATTCTCGTAAGCGGCGGCGGCGCGGTGACGGCGCAAGGGAGGGCGGAGAGGTACGAGACTACG
GGGTTCGTGCTGCAGAACTGCACGGTGAAGGGGATTGGTGGCGGTGAGATTGTGTTGGGGAGGCCGTGGAGGAAGAGGTCGAGAGCGGTGGTGATGGAGT
CGTATTTGGGGGGAAATGTGGCAGCAGAAGGGTGGAAGGTCACTGCCGTCGGAGGTGCCGGAGGAGGGGAGGTGGCGCCGGCGGAGGAGAAGTATTATTA
CGCGGAGTTTGGAAACTATGGGCCAGGGTCGGGTACGGATAAGCGGGTTCGGGGCCCGAAGGTGCTGAATAAGGATGGGTCGGATGCGGTTCAGTATGGT
CCGAGTTTGTTTATTCAAGGGGATGAGTGGATTGCTCAGGCTGGTGTGCCGTTTCGCGGAGGATTATAA
AA sequence
>Lus10005678 pacid=23168898 polypeptide=Lus10005678 locus=Lus10005678.g ID=Lus10005678.BGIv1.0 annot-version=v1.0
MSIDNRAKRAAGNSSSAAAVTAVAVRVQADKSAFYNCTIEGGKSALYALAHRQFYSGCKISGSGDLIIGDAAAVIQDSEILVSGGGAVTAQGRAERYETT
GFVLQNCTVKGIGGGEIVLGRPWRKRSRAVVMESYLGGNVAAEGWKVTAVGGAGGGEVAPAEEKYYYAEFGNYGPGSGTDKRVRGPKVLNKDGSDAVQYG
PSLFIQGDEWIAQAGVPFRGGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33230 Plant invertase/pectin methyle... Lus10005678 0 1
AT5G41020 MYB myb family transcription facto... Lus10022926 1.4 0.8823
AT2G22140 ATEME1B essential meiotic endonuclease... Lus10006798 1.4 0.8090
AT3G24080 KRR1 family protein (.1.2) Lus10028084 4.6 0.8009
AT5G56360 PSL4 PRIORITY IN SWEET LIFE 4, calm... Lus10013398 5.5 0.7952
AT5G44310 Late embryogenesis abundant pr... Lus10028304 7.3 0.7720
AT5G49120 Protein of unknown function (D... Lus10006499 9.4 0.7957
AT5G43490 unknown protein Lus10003153 9.5 0.7853
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Lus10028997 12.7 0.7851
AT4G02340 alpha/beta-Hydrolases superfam... Lus10026141 15.7 0.6938
AT3G14900 EMB3120 EMBRYO DEFECTIVE 3120, unknown... Lus10000244 18.6 0.7389

Lus10005678 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.