Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18150 107 / 2e-32 Methyltransferase-related protein (.1) AT5G14602 92 / 2e-26 unknown protein AT5G58375 69 / 5e-17 Methyltransferase-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020287 [exp] 166 / 3e-55 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1) Lus10034423 [exp] 90 / 6e-25 AT5G18150 87 / 5e-24 Methyltransferase-related protein (.1) Lus10019138 [exp] 86 / 2e-23 AT5G18150 80 / 3e-21 Methyltransferase-related protein (.1) Lus10008585 [exp] 64 / 9e-15 AT5G58375 89 / 1e-24 Methyltransferase-related protein (.1) Lus10042227 [exp] 64 / 1e-14 AT5G58375 91 / 2e-25 Methyltransferase-related protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G058200 [exp] 119 / 7e-37 AT5G18150 114 / 5e-35 Methyltransferase-related protein (.1) Potri.019G035000 [exp] 115 / 1e-35 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1) Potri.013G155800 [exp] 66 / 1e-15 AT5G58375 67 / 5e-16 Methyltransferase-related protein (.1) Potri.019G127900 [exp] 58 / 1e-12 AT5G58375 64 / 6e-15 Methyltransferase-related protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005698 pacid=23168884 polypeptide=Lus10005698 locus=Lus10005698.g ID=Lus10005698.BGIv1.0 annot-version=v1.0 ATGTGTCCTATGCGGTTCATTCTGGTCTTCTTCTCTGCAATTCTGGCTGGCTACTTCGCCTGGAAGACGGTGAGCACTTCTCCCGTCGACGAAGGCAACT CCGGTGATTCCGCGGCCGACAAGGCTGCTACTGATGTCAAGAAGCAGGAATCCAGCACGGTCAAGATGATTCAGAATGGGTTCTGGGTGTTTGTGAACAT GGCGAGTGGGAGGTACCTGTGGAGAAACATCAAGGAAATGAAGAAGCAAGAGAGTTCATGA
AA sequence Show only first row Show all	>Lus10005698 pacid=23168884 polypeptide=Lus10005698 locus=Lus10005698.g ID=Lus10005698.BGIv1.0 annot-version=v1.0 MCPMRFILVFFSAILAGYFAWKTVSTSPVDEGNSGDSAADKAATDVKKQESSTVKMIQNGFWVFVNMASGRYLWRNIKEMKKQESS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18150			Methyltransferase-related prot...		Lus10005698 [exp]	0	1
AT4G35030			Protein kinase superfamily pro...		Lus10013566 [exp]	1.0	0.9608
					Lus10040377 [exp]	3.6	0.9446
AT5G23160			unknown protein		Lus10017395 [exp]	4.2	0.9604
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10036296 [exp]	4.5	0.9550
AT3G59310			Eukaryotic protein of unknown ...		Lus10003247 [exp]	4.7	0.9473
AT1G23440			Peptidase C15, pyroglutamyl pe...		Lus10013026 [exp]	6.0	0.9555
AT5G16120			alpha/beta-Hydrolases superfam...		Lus10009169 [exp]	8.1	0.9571
AT3G01850			Aldolase-type TIM barrel famil...		Lus10035219 [exp]	8.5	0.9496
AT4G18360			Aldolase-type TIM barrel famil...		Lus10023302 [exp]	11.2	0.9547
AT1G03590			Protein phosphatase 2C family ...		Lus10033708 [exp]	12.0	0.9406

Compare expression of checked genes

Lus10005698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.