Lus10005699 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18140 50 / 8e-08 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020286 124 / 3e-35 AT5G18140 265 / 3e-87 Chaperone DnaJ-domain superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G058100 57 / 4e-10 AT5G18140 264 / 1e-86 Chaperone DnaJ-domain superfamily protein (.1)
Potri.019G035100 52 / 2e-08 AT5G18140 225 / 3e-71 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10005699 pacid=23168882 polypeptide=Lus10005699 locus=Lus10005699.g ID=Lus10005699.BGIv1.0 annot-version=v1.0
ATGAGGAAAGGGTCTACAGGTGGGCAGAAGCAAAGCGGAGGAGAATGGCTTATTATGATGCTGAAGAAGAGGATGAAGAAGACTCTAATAATGGCTGAAG
AAGAAGGAAGAAGCTCGGGTCAAGAGAGGGCGCCTTTCGTTGAAGTGCTGAAGTCTGCATTTTTATCACTCTTCTTACTCAAGACGTTGGGAGCTCAAGT
CTCGATCACGTGCAGCAGCCTGATGGCAATGTTCGATCCGAAGCTGGATGCTGGATATAAAACGGGCTCACTCCCTGGTAGCGTTTTTCAGCTGGCTATT
ATGTTAGTTGTAGCGCGCCTTCCCTCCTTCTCCTTCTCTCACTTCGGAAAGATTTTTTCAGCTCCTTTGCCGACGGGTGCTGTCCTTACGCTTCTTCACA
TGTCAATGAAGCTGCAGGTTGACCTTACTTGA
AA sequence
>Lus10005699 pacid=23168882 polypeptide=Lus10005699 locus=Lus10005699.g ID=Lus10005699.BGIv1.0 annot-version=v1.0
MRKGSTGGQKQSGGEWLIMMLKKRMKKTLIMAEEEGRSSGQERAPFVEVLKSAFLSLFLLKTLGAQVSITCSSLMAMFDPKLDAGYKTGSLPGSVFQLAI
MLVVARLPSFSFSHFGKIFSAPLPTGAVLTLLHMSMKLQVDLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18140 Chaperone DnaJ-domain superfam... Lus10005699 0 1
AT5G11530 EMF1 embryonic flower 1 (EMF1) (.1) Lus10009490 2.0 0.9556
AT2G17930 Phosphatidylinositol 3- and 4-... Lus10041910 3.0 0.9593
AT2G34680 AIR9 AUXIN-INDUCED IN ROOT CULTURES... Lus10038534 4.5 0.9302
AT1G04210 Leucine-rich repeat protein ki... Lus10021899 5.2 0.9452
AT3G12440 Polynucleotidyl transferase, r... Lus10000103 7.7 0.9536
AT1G16800 P-loop containing nucleoside t... Lus10037304 9.6 0.9523
AT2G24430 NAC ANAC039, ANAC03... Arabidopsis NAC domain contain... Lus10022965 9.8 0.9497
Lus10002928 12.5 0.9415
AT1G70640 octicosapeptide/Phox/Bem1p (PB... Lus10008047 13.0 0.9444
AT5G09470 DIC3 dicarboxylate carrier 3 (.1) Lus10024540 14.3 0.9505

Lus10005699 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.